Factor XIII B Polypeptide antibody

• Catalog number
  70R-5445
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  Factor XIII B Polypeptide antibodies were raised using the N terminal of F13B corresponding to a region with amino acids MRLKNLTFIIILIISGELYAEEKPCGFPHVENGRIAQYYYTFKSFYFPMS
• Raised in
  Rabbit
• Specificity
  Factor XIII B Polypeptide antibody was raised against the N terminal of F13B
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of F13B antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  Factor XIII B Polypeptide Blocking Peptide, catalog no. 33R-6368, is also available for use as a blocking control in assays to test for specificity of this Factor XIII B Polypeptide antibody
• Additional Information
  This is a rabbit polyclonal antibody against F13B, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• Description
  Aplha, transcription related growth factors and stimulating factors or repressing nuclear factors are complex subunits of proteins involved in cell differentiation. Complex subunit associated factors are involved in hybridoma growth, Eosinohils, eritroid proliferation and derived from promotor binding stimulating subunits on the DNA binding complex. NFKB 105 subunit for example is a polypetide gene enhancer of genes in B cells.
• French translation
  anticorps

• Gene target
  Factor   XIII   Polypeptide  
• Gene symbol
  F13B
• Short name
  Factor XIII B Polypeptide antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal Factor XIII B Polypeptide antibody raised against the N terminal of F13B
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3534
• Gene
  F13B
• Long gene name
  coagulation factor XIII B chain
• Synonyms gene name
  • coagulation factor XIII, B polypeptide
• Synonyms
  • FXIIIB
• GenBank acession
  • M14057
• Locus
  1q31.3
• Discovery year
  2001-06-22
• Entrez gene record
  2165
• Pubmed identfication
  • 2339067
  • 2271707
• RefSeq identity
  • NM_001994
• Classification
  • Sushi domain containing
• VEGA ID
  OTTHUMG00000036519
• Locus Specific Databases
  • LRG_550

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products