Estrogen-Related Receptor Gamma Blocking Peptide
-
Catalog number
33R-9206
-
Price
Please ask
-
Size
100 µg
-
-
Category
Proteins
-
Antibody Subtype
Blocking Peptides
-
Area of research
Hormones & Steroids
-
Residues
TMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
-
Type of protein
Synthetic
-
Form Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
-
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
-
Shipping conditions
Blue Ice
-
Tested for
WB; IHC
-
-
-
Test
You can block the antibody by the specific target amino acid sequence of peptide.
-
Properties
blocking peptide
-
Description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs. The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
Gene target
-
Gene symbol
ESRRG
-
Short name
Estrogen- Receptor Gamma Blocking Peptide
-
Technique
blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
-
Alternative name
A synthetic peptide for use as a blocking control in assays to test for specificity of ESRRG antibody, catalog no. 70R-2648
-
Alternative technique
control, peptides
-
Gene info
Similar products