DPCR1 antibody

• Catalog number
  70R-7023
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Miscellaneous
• Type of Immunogen
  DPCR1 antibodies were raised using the C terminal of DPCR1 corresponding to a region with amino acids SHLNKTEVTHQVPTGSFTLITSRTKLSSITSEATGNESHPYLNKDGSQKG
• Raised in
  Rabbit
• Specificity
  DPCR1 antibody was raised against the C terminal of DPCR1
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DPCR1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  DPCR1 Blocking Peptide, catalog no. 33R-8512, is also available for use as a blocking control in assays to test for specificity of this DPCR1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against DPCR1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DPCR1  
• Gene symbol
  MUCL3
• Short name
  DPCR1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal DPCR1 antibody raised against the C terminal of DPCR1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:21666
• Gene
  MUCL3
• Long gene name
  mucin like 3
• Synonyms gene
  • DPCR1
• Synonyms gene name
  • diffuse panbronchiolitis critical region 1
• Synonyms
  • PBLT
  • bCX105N19.6
  • C6orf37
• GenBank acession
  • AB064272
• Locus
  6p21.33
• Discovery year
  2004-02-03
• Entrez gene record
  135656
• Pubmed identfication
  • 12185533
  • 10677310
• RefSeq identity
  • NM_080870
• VEGA ID
  OTTHUMG00000031104

MeSH Data

• Name
  Polymerase Chain Reaction
• Concept
  Scope note: In vitro method for producing large amounts of specific DNA or RNA fragments of defined length and sequence from small amounts of short oligonucleotide flanking sequences (primers). The essential steps include thermal denaturation of the double-stranded target molecules, annealing of the primers to their complementary sequences, and extension of the annealed primers by enzymatic synthesis with DNA polymerase. The reaction is efficient, specific, and extremely sensitive. Uses for the reaction include disease diagnosis, detection of difficult-to-isolate pathogens, mutation analysis, genetic testing, DNA sequencing, and analyzing evolutionary relationships.
• Tree numbers
  • E05.393.620.500
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products