DLC1 antibody
-
Catalog number70R-1946
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchCancer
-
Type of ImmunogenDLC1 antibodies were raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL
-
Raised inRabbit
-
SpecificityDLC1 antibody was raised against the C terminal of DLC1
-
Cross ReactivityHuman,Mouse,Rat
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of DLC1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 0.5 ug/ml
-
Assay InformationDLC1 Blocking Peptide, catalog no. 33R-6752, is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against DLC1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolDLEC1, DYNLL1, DLC1
-
Short nameDLC1 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal DLC1 antibody raised against the C terminal of DLC1
-
Alternative techniqueantibodies
-
Alternative to gene targetdeleted in liver cancer 1, ARHGAP7 and HP and p122-RhoGAP and STARD12, DLC1 and IDBG-7954 and ENSG00000164741 and 10395, SH2 domain binding, nuclei, Dlc1 and IDBG-149173 and ENSMUSG00000031523 and 50768, BT.24236 and IDBG-628726 and ENSBTAG00000015541 and 511433
-
Gene info
-
Identity
-
Gene
-
Long gene nameDLEC1 cilia and flagella associated protein
-
Synonyms gene name
- deleted in lung and esophageal cancer 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-05-07
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Cilia and flagella associated
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namedynein light chain LC8-type 1
-
Synonyms gene
-
Synonyms gene name
- dynein, cytoplasmic, light polypeptide 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-12-18
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Dyneins, axonemal inner arm I1/f complex subunits
- Dynein 2 complex subunits
- Dynein 1 complex subunits
- Dyneins, axonemal outer arm complex subunits
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameDLC1 Rho GTPase activating protein
-
Synonyms gene name
- deleted in liver cancer 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-06-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- StAR related lipid transfer domain containing
- Rho GTPase activating proteins
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data