CYP1A1 Blocking Peptide

• Catalog number
  33R-2944
• Price
  Please ask
• Size
  100 µg

• Category
  Proteins
• Antibody Subtype
  Blocking Peptides
• Area of research
  Proteases, Inhibitors, & Enzymes
• Residues
  FKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANV
• Type of protein
  Synthetic
• Form Buffer
  Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
• Storage
  Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB; IHC
• URL
• More info
• Test
  You can block the antibody by the specific target amino acid sequence of peptide.
• Properties
  blocking peptide
• Description
  Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.

• Gene target
  CYP1A1  
• Gene symbol
  CYP1A1
• Short name
  CYP1A1 Blocking Peptide
• Technique
  blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
• Alternative name
  A synthetic peptide for use as a blocking control in assays to test for specificity of CYP1A1 antibody, catalog no. 70R-7256
• Alternative technique
  control, peptides
• Alternative to gene target
  cytochrome P450, family 1, subfamily A, polypeptide 1, AHH and AHRR and CP11 and CYP1 and P1-450 and P450-C and P450DX, CYP1A1 and IDBG-22475 and ENSG00000140465 and 1543, oxidoreductase activity, Cytoplasm, Cyp1a1 and IDBG-170677 and ENSMUSG00000032315 and 13076, CYP1A1 and IDBG-631735 and ENSBTAG00000001021 and 282870

Gene info

• Identity
  HGNC:2595
• Gene
  CYP1A1
• Long gene name
  cytochrome P450 family 1 subfamily A member 1
• Synonyms gene
  • CYP1
• Synonyms gene name
  • cytochrome P450, subfamily I (aromatic compound-inducible), polypeptide 1
  • cytochrome P450, family 1, subfamily A, polypeptide 1
• Synonyms
  • P450DX
  • P1-450
  • P450-C
  • CP11
• GenBank acession
  • BC023019
• Locus
  15q24.1
• Discovery year
  1986-01-01
• Entrez gene record
  1543
• Pubmed identfication
  • 15128046
• RefSeq identity
  • NM_000499
• Classification
  • Cytochrome P450 family 1
• VEGA ID
  OTTHUMG00000142812
• Locus Specific Databases
  • PharmVar Human Cytochrome P450 (CYP) Allele Nomenclature
  • LRG_1262

Similar products