CXorf66 antibody
-
Catalog number70R-6484
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchDNA & RNA
-
Type of ImmunogenCXorf66 antibodies were raised using the middle region of CXorf66 corresponding to a region with amino acids PLYSSHPQNEISPSKPFGPQELAKPPKHFNPKRSVSLGRAALLSNSELAE
-
Raised inRabbit
-
SpecificityCXorf66 antibody was raised against the middle region of CXorf66
-
Cross ReactivityHuman
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CXorf66 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 1 ug/ml
-
Assay InformationCXorf66 Blocking Peptide, catalog no. 33R-7216, is also available for use as a blocking control in assays to test for specificity of this CXorf66 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against RP11-35F15.2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolCXorf66
-
Short nameCXorf66 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal CXorf66 antibody raised against the middle region of CXorf66
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namechromosome X open reading frame 66
-
Synonyms
-
Synonyms name
-
Locus
-
Discovery year2009-03-20
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data