Crystallin Beta A1 antibody

• Catalog number
  70R-2029
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  Crystallin Beta A1 antibodies were raised using the N terminal of CRYBA1 corresponding to a region with amino acids METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS
• Raised in
  Rabbit
• Specificity
  Crystallin Beta A1 antibody was raised against the N terminal of CRYBA1
• Cross Reactivity
  Human,Mouse,Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CRYBA1 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  Crystallin Beta A1 Blocking Peptide, catalog no. 33R-5973, is also available for use as a blocking control in assays to test for specificity of this Crystallin Beta A1 antibody
• Additional Information
  This is a rabbit polyclonal antibody against CRYBA1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Crystallin   Beta  
• Gene symbol
  CRYBA1
• Short name
  Crystallin Beta A1 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal Crystallin Beta A1 antibody raised against the N terminal of CRYBA1
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:2394
• Gene
  CRYBA1
• Long gene name
  crystallin beta A1
• Synonyms gene
  • CRYB1
• Synonyms gene name
  • crystallin, beta A1
• Synonyms name
  • eye lens structural protein
• Locus
  17q11.2
• Discovery year
  1986-01-01
• Entrez gene record
  1411
• Pubmed identfication
  • 3745196
  • 3770741
• RefSeq identity
  • NM_005208
• Classification
  • Beta-gamma crystallins
• VEGA ID
  OTTHUMG00000132729
• Locus Specific Databases
  • Global Variome shared LOVD

MeSH Data

• Name
  Crystallization
• Concept
  Scope note: The formation of crystalline substances from solutions or melts. (McGraw-Hill Dictionary of Scientific and Technical Terms, 4th ed)
• Tree numbers
  • E05.196.300
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products