COPG2 antibody

• Catalog number
  70R-3831
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Cell Biology
• Type of Immunogen
  COPG2 antibodies were raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK
• Raised in
  Rabbit
• Specificity
  COPG2 antibody was raised against the N terminal of COPG2
• Cross Reactivity
  Human, Mouse, Rat
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COPG2 antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  COPG2 Blocking Peptide, catalog no. 33R-6111, is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody
• Additional Information
  This is a rabbit polyclonal antibody against COPG2, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  COPG2  
• Gene symbol
  COPG2
• Short name
  COPG2 antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal COPG2 antibody raised against the N terminal of COPG2
• Alternative technique
  antibodies
• Alternative to gene target
  coatomer protein complex, subunit gamma 2, COPG2 and IDBG-41551 and ENSG00000158623 and 26958, binding, Plasma membranes, Copg2 and IDBG-133459 and ENSMUSG00000025607 and 54160, COPG2 and IDBG-635526 and ENSBTAG00000017245 and 536616

Gene info

• Identity
  HGNC:2237
• Gene
  COPG2
• Long gene name
  COPI coat complex subunit gamma 2
• Synonyms gene name
  • coatomer protein complex, subunit gamma 2
• Synonyms
  • 2-COP
• Synonyms name
  • coat protein, nonclathrin, gamma-2-cop
• GenBank acession
  • AF157833
• Locus
  7q32.2
• Discovery year
  1999-12-17
• Entrez gene record
  26958
• Pubmed identfication
  • 10556286
  • 10995575
• RefSeq identity
  • NM_012133
• Classification
  • Clathrin/coatomer adaptor, adaptin-like, N-terminal domain containing
  • COPI coat complex
• VEGA ID
  OTTHUMG00000155364

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products