CD4 Blocking Peptide

  • Catalog number
    33R-9659
  • Price
    Please ask
  • Size
    100 µg
  • Category
    Proteins
  • Antibody Subtype
    Blocking Peptides
  • Area of research
    Cell Biology
  • Residues
    VLGGVAGLLLFIGLGIFFCVRCRHRRRQAERMSQIKRLLSEKKTCQCPHR
  • Type of protein
    Synthetic
  • Form Buffer
    Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
  • Storage
    Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
  • Shipping conditions
    Blue Ice
  • Tested for
    WB; IHC
  • URL
  • Test
    You can block the antibody by the specific target amino acid sequence of peptide.
  • Properties
    blocking peptide
  • Description
    CD4+ T helper cell marker or cluster differentiator of white blood cells in FACS or flow cytometry. Used offer coupled to magnetic beads. GENTAUR makes custom magnetic bead couplings on 50 and 250 nm beads for certain clones. Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
  • Gene target
    CD4  
  • Gene symbol
    CD4
  • Short name
    CD4 Blocking Peptide
  • Technique
    blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
  • Alternative name
    A synthetic peptide for use as a blocking control in assays to test for specificity of CD4 antibody, catalog no. 70R-9673
  • Alternative technique
    control, peptides
  • Alternative to gene target
    CD4 molecule, CD4mut, CD4 and IDBG-15034 and ENSG00000010610 and 920, protein homodimerization activity, Cell surfaces, Cd4 and IDBG-188351 and ENSMUSG00000023274 and 12504, CD4 and IDBG-640247 and ENSBTAG00000003255 and 407098
Gene info
  • Identity
  • Gene
    CD4
  • Long gene name
    CD4 molecule
  • Synonyms gene name
    • CD4 antigen (p55)
    • T-cell surface glycoprotein CD4
  • GenBank acession
  • Locus
  • Discovery year
    1986-01-01
  • Entrez gene record
    920
  • RefSeq identity
  • Classification
    • CD molecules
    • C2-set domain containing
    • V-set domain containing
  • VEGA ID
Similar products
Filters
Contact
Chat with gentaur.com employee