CAMK1G antibody

• Catalog number
  70R-4089
• Price
  Please ask
• Size
  50 µg

• Category
  Primary Antibody
• Antibody Subtype
  Polyclonal Antibodies, Purified
• Area of research
  Signal Transduction
• Type of Immunogen
  CAMK1G antibodies were raised using the middle region of CAMK1G corresponding to a region with amino acids KDFICHLLEKDPNERYTCEKALSHPWIDGNTALHRDIYPSVSLQIQKNFA
• Raised in
  Rabbit
• Specificity
  CAMK1G antibody was raised against the middle region of CAMK1G
• Cross Reactivity
  Human
• Method of Purification
  Affinity purified
• Concentration
  1 mg/ml
• Form Buffer
  Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMK1G antibody in PBS
• Storage
  Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
• Shipping conditions
  Blue Ice
• Tested for
  WB
• Usage Recommendations
  WB: 1 ug/ml
• Assay Information
  CAMK1G Blocking Peptide, catalog no. 33R-4285, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody
• Additional Information
  This is a rabbit polyclonal antibody against CAMK1G, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
• URL
• More info
• Properties
  If you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  CAMK1G  
• Gene symbol
  CAMK1G
• Short name
  CAMK1G antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Rabbit polyclonal CAMK1G antibody raised against the middle region of CAMK1G
• Alternative technique
  antibodies
• Alternative to gene target
  calcium/calmodulin-dependent protein kinase IG, CAMK1G and IDBG-106416 and ENSG00000008118 and 57172, transferase activity, Plasma membranes, Camk1g and IDBG-209251 and ENSMUSG00000016179 and 215303, BT.30982 and IDBG-638399 and ENSBTAG00000016541 and 511504

Gene info

• Identity
  HGNC:14585
• Gene
  CAMK1G
• Long gene name
  calcium/calmodulin dependent protein kinase IG
• Synonyms gene name
  • calcium/calmodulin-dependent protein kinase IG
• Synonyms
  • VWS1
  • CLICKIII
  • dJ272L16.1
• Locus
  1q32.2
• Discovery year
  2001-03-21
• Entrez gene record
  57172
• Pubmed identfication
  • 12637513
• RefSeq identity
  • NM_020439
• Classification
  • Calmodulin dependent protein kinases
• VEGA ID
  OTTHUMG00000036361

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products