CACNA2D1 antibody
-
Catalog number70R-5102
-
PricePlease ask
-
Size50 µg
-
-
CategoryPrimary Antibody
-
Antibody SubtypePolyclonal Antibodies, Purified
-
Area of researchSignal Transduction
-
Type of ImmunogenCACNA2D1 antibodies were raised using the middle region of CACNA2D1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
-
Raised inRabbit
-
SpecificityCACNA2D1 antibody was raised against the middle region of CACNA2D1
-
Cross ReactivityHuman, Mouse, Rat, Dog
-
Method of PurificationAffinity purified
-
Concentration1 mg/ml
-
Form BufferLyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNA2D1 antibody in PBS
-
StorageStore at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.
-
Shipping conditionsBlue Ice
-
Tested forWB
-
Usage RecommendationsWB: 0.12 ug/ml
-
Assay InformationCACNA2D1 Blocking Peptide, catalog no. 33R-7178, is also available for use as a blocking control in assays to test for specificity of this CACNA2D1 antibody
-
Additional InformationThis is a rabbit polyclonal antibody against CACNA2D1, which has been validated by Western Blot. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire at [email protected]
-
PropertiesIf you buy Antibodies supplied by fitzgerald they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolCACNA2D1-AS1, CACNA2D1
-
Short nameCACNA2D1 antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameRabbit polyclonal CACNA2D1 antibody raised against the middle region of CACNA2D1
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameCACNA2D1 antisense RNA 1
-
Locus
-
Discovery year2019-07-24
-
Entrez gene record
-
RefSeq identity
-
Classification
- Antisense RNAs
Gene info
-
Identity
-
Gene
-
Long gene namecalcium voltage-gated channel auxiliary subunit alpha2delta 1
-
Synonyms gene
-
Synonyms gene name
- long intergenic non-protein coding RNA 1112
- calcium channel, voltage-dependent, alpha 2/delta subunit 1
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1992-03-27
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Calcium voltage-gated channel auxiliary alpha2delta subunits
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Electrophoresis in which a second perpendicular electrophoretic transport is performed on the separate components resulting from the first electrophoresis. This technique is usually performed on polyacrylamide gels.
-
Tree numbers
- E05.196.401.250
- E05.301.300.230
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data