-
Product Type
Proteins
-
Product Subtype
Blocking Peptides
-
Research Area
Proteases, Inhibitors, & Enzymes
-
Tag Conjugate
LEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSK
-
Type1
Synthetic
-
Form Buffer
Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.
-
Storage
Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.
-
Applications
WB, IHC
-
Shipping Info
Blue Ice
-
Test
You can block the antibody by the specific target amino acid sequence of peptide.
-
Properties
blocking peptide
-
Description
Peptides short amino acid chains or epitopes or blocking antagonists. The shortest peptides are dipeptides, consisting of 2 amino acids joined by a single peptide bond, followed by tripeptides, tetra peptides, ... till polypeptides that are long, continuous, and unbranched synthetic peptide chains. These biological oligomers and polymers can be Solid-phase peptide synthesis (SPPS), or in continue produced for custom peptide synthesis projects. The High-efficiency solid phase peptide synthesis (HE-SPPS) is give very low production costs.
-
Gene target
-
Gene symbol
AKR1C2
-
Short name
AKR1C2 Blocking Peptide
-
Technique
blocking peptide, Blocking, peptide, blocking peptides, fitzgerald made this blocking amino acid sequence or peptide to block the gene target in a volume of 1. For western blot it is often requested to block your antibody and to see the band of the analyzed protein disappear. This is called a negative control by blocking the WB antibody. peptides
-
Alternative name
aldo-keto reductase family 1, member complement component 2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-a hydroxysteroid dehydrogenase, classification III) inhibiting short protein sequence
-
Alternative technique
control, peptides
-
Alternative to gene target
aldo-keto reductase family 1, member C2 (dihydrodiol dehydrogenase 2; bile acid binding protein; 3-alpha hydroxysteroid dehydrogenase, type III), AKR1C-pseudo and BABP and DD and DD2 and DDH2 and HAKRD and HBAB and MCDR2 and SRXY8 and TDD, AKR1C2 and IDBG-47297 and ENSG00000151632 and 1646, oxidoreductase activity, Cytoplasm
-