Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC

  • Catalog number
    PAB257Mu01-20ul-APC
  • Price
    Please ask
  • Size
    20ul
  • Description
    A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC.
  • Specifications
    Host: Rabbit; Species Reactivity: Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: APC
  • Additional_information
    Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA); Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
  • Storage_and_shipping
    Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
  • Notes
    Research Use Only.
  • Properties
    If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • Test
    Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
  • Latin name
    Mus musculus
  • Group
    Polyclonals and antibodies
  • About
    Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
  • Additional description
    The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
  • French translation
    anticorps
  • Gene target
    Scavenger   Receptor   Class   Member   SCARD1   APC  
  • Gene symbol
    APC, CD68
  • Short name
    Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC
  • Technique
    Polyclonal, Antibody, Mouse, antibodies against human proteins, antibodies for, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
  • Host
    mouse
  • Label
    APC
  • Species
    Mouse, Mouses
  • Alternative name
    Scavenger Receptor Class D Member 1 (SCARD1) polyclonal (antibody to-) (Mouse), adenomatous polyposis coli
  • Alternative technique
    polyclonals, antibodies, murine
  • Alternative to gene target
    adenomatous polyposis coli, BTPS2 and DP2 and DP2.5 and DP3 and GS and PPP1R46, APC and IDBG-37007 and ENSG00000134982 and 324, microtubule plus-end binding, nuclei, Apc and IDBG-134573 and ENSMUSG00000005871 and 11789, BT.25770 and IDBG-644937 and ENSBTAG00000018852 and 533233
Gene info
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Product images
Similar products
Filters
Contact
Chat with gentaur.com employee