-
Description
A Rabbit polyclonal antibody against Mouse Scavenger Receptor Class D Member 1 (SCARD1). This antibody is labeled with APC.
-
Specifications
Host: Rabbit; Species Reactivity: Mouse; Clonality: polyclonal; Tested applications: WB, IHC; Concentration: 500ug/ml; Isotype: IgG; Conjugation: APC
-
Additional_information
Sequence of the immunogen: SCARD1 (Ala27~Pro282+TCLSHFLMDSLPLDSNRTYIRARVQSTWTTWRWNTMCPSHRQHSGHSWRRIHLFESSKLPWAKASAVEMQA); Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
-
Storage_and_shipping
Upon receipt, store at -20°C or -80°C. Prepare working aliqotes prior to storage to avoid repeated freeze-thaw cycles.
-
Notes
Research Use Only.
-
Properties
If you buy Antibodies supplied by Cloud Clone Corp they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
Test
Mouse or mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab. Mouse are mature after 40 days for females and 55 days for males. The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year. Transgenic, knock-out, congenic and inbread strains are known for C57BL/6, A/J, BALB/c, SCID while the CD-1 is outbred as strain.
-
Latin name
Mus musculus
-
Group
Polyclonals and antibodies
-
About
Polyclonals can be used for Western blot, immunohistochemistry on frozen slices or parrafin fixed tissues. The advantage is that there are more epitopes available in a polyclonal antiserum to detect the proteins than in monoclonal sera.
-
Additional description
The receptors are ligand binding factors of type 1, 2 or 3 and protein-molecules that receive chemical-signals from outside a cell. When such chemical-signals couple or bind to a receptor, they cause some form of cellular/tissue-response, e.g. a change in the electrical-activity of a cell. In this sense, am olfactory receptor is a protein-molecule that recognizes and responds to endogenous-chemical signals, chemokinesor cytokines e.g. an acetylcholine-receptor recognizes and responds to its endogenous-ligand, acetylcholine. However, sometimes in pharmacology, the term is also used to include other proteins that are drug-targets, such as enzymes, transporters and ion-channels.
-
French translation
anticorps
-
Gene target
-
Gene symbol
APC, CD68
-
Short name
Scavenger Receptor Class D Member 1 (SCARD1) Polyclonal Antibody (Mouse), APC
-
Technique
Polyclonal, Antibody, Mouse, antibodies against human proteins, antibodies for, mouses, Polyclonal antibodies (pAbs) are mostly rabbit or goat antibodies that are secreted by different B cells, whereas monoclonal antibodies come from a single N cell lineage. Pabs are a collection of immunoglobulin molecules that react against a specific antigen, each identifying a different epitope.
-
Host
mouse
-
Label
APC
-
Species
Mouse, Mouses
-
Alternative name
Scavenger Receptor Class D Member 1 (SCARD1) polyclonal (antibody to-) (Mouse), adenomatous polyposis coli
-
Alternative technique
polyclonals, antibodies, murine
-
Alternative to gene target
adenomatous polyposis coli, BTPS2 and DP2 and DP2.5 and DP3 and GS and PPP1R46, APC and IDBG-37007 and ENSG00000134982 and 324, microtubule plus-end binding, nuclei, Apc and IDBG-134573 and ENSMUSG00000005871 and 11789, BT.25770 and IDBG-644937 and ENSBTAG00000018852 and 533233
-