-
Target antigen
ZP2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ZP2 (511-544aa ENEYPLVRFLRQPIYMEVRVLNRDDPNIKLVLDD), different from the related mouse sequence by six amino acids, and from the related rat sequence by four amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ZP2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ZP2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Zona pellucida sperm-binding protein 2 is a protein that in humans is encoded by the ZP2 gene. The sperm-binding domain on the ZP2 protein is necessary in both humans and mice for oocyte-sperm recognition and penetration of the zona pellucida. It is also responsible for the primary block to polyspermy in mammals. The oocyte has cortical granules peripherally located under the cortex that contain a proteolytic protein called ovastacin. After the sperm binds to ZP2, the cortical granules are exocytosed releasing ovastacin into the perivitelline space. Ovastacin cleaves ZP2 at the N terminus, preventing more sperm from binding and penetrating the oocyte, thus hardening the zona pellucida. Ovastacin is only found in oocytes, and is part of the astacin family of metalloendoproteases. Female mice engineered without ovastacin showed that ZP2 was not cleaved after fertilization.
-
Related articles
1. "Entrez Gene: ZP2 zona pellucida glycoprotein 2 (sperm receptor)". 2. Burkart AD, Xiong B, Baibakov B, Jiménez-Movilla M, Dean J. "Ovastacin, a cortical granule protease, cleaves ZP2 in the zona pellucida to prevent polyspermy.". J Cell Biol 197: 37–44. 3. Liang LF, Dean J (Apr 1993). "Conservation of mammalian secondary sperm receptor genes enables the promoter of the human gene to function in mouse oocytes". Dev Biol 156 (2): 399–408.
-
Gene Name
ZP2
-
Protein Name
Zona pellucida sperm-binding protein 2
-
Gene Full Name
zona pellucida glycoprotein 2 (sperm receptor)
-
Synonyms
OTTHUMP00000115849 antibody|Processed zona pellucida sperm-binding protein 2 antibody|Zona pellucida glycoprotein 2 antibody|zona pellucida glycoprotein ZP2 antibody|Zona pellucida protein A antibody|Zp-2 antibody|ZP2 antibody|ZP2_HUMAN antibody|ZPA antibody
-
Uniprot ID
Q05996
-
Entrez GeneID
7783
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
