XPA Antibody

• Catalog number
  A01182-2
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  XPA
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human XPA (174-208aa QWGDMKLYLKLQIVKRSLEVWGSQEALEEAKEVRQ), different from the related mouse sequence by three amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the XPA Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The XPA Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  DNA repair protein complementing XP-A cells is a protein that in humans is encoded by the XPA gene. This gene encodes a zinc finger protein involved in DNA excision repair. The encoded protein is part of the NER (nucleotide excision repair) complext which is responsible for repair of UV radiation-induced photoproducts and DNA adducts induced by chemical carcinogens. Mutations in this gene are associated with xeroderma pigmentosum complementation group A. Alternatively spliced transcript variants have been found for this gen.
• Related articles
  1. Li L, Elledge SJ, Peterson CA, Bales ES, Legerski RJ (May 1994). "Specific association between the human DNA repair proteins XPA and ERCC1". Proceedings of the National Academy of Sciences of the United States of America. 91 (11): 5012–6. 2. Nagai A, Saijo M, Kuraoka I, Matsuda T, Kodo N, Nakatsu Y, Mimaki T, Mino M, Biggerstaff M, Wood RD (Jun 1995). "Enhancement of damage-specific DNA binding of XPA by interaction with the ERCC1 DNA repair protein". Biochemical and Biophysical Research Communications. 211 (3): 960–6.
• Gene Name
  XPA
• Protein Name
  DNA repair protein complementing XP-A cells
• Gene Full Name
  XPA, DNA damage recognition and repair factor
• Synonyms
  XP 1 | XP1 | xpa | Xpac | P23025
• Uniprot ID
  P23025
• Entrez GeneID
  7507
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  XPA  
• Gene symbol
  XPA
• Short name
  XPA Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  xeroderma pigmentosum, complementation group A (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  xeroderma pigmentosum, complementation group A, XPA and IDBG-78000 and ENSG00000136936 and 7507, metal ion binding, nuclei, Xpa and IDBG-145025 and ENSMUSG00000028329 and 22590, XPA and IDBG-633992 and ENSBTAG00000009734 and 537958

Gene info

• Identity
  HGNC:12814
• Gene
  XPA
• Long gene name
  XPA, DNA damage recognition and repair factor
• Synonyms gene name
  • xeroderma pigmentosum, complementation group A
• Synonyms
  • XPAC
  • XP1
• GenBank acession
  • D14533
• Locus
  9q22.33
• Discovery year
  1990-09-10
• Entrez gene record
  7507
• RefSeq identity
  • NM_000380
• Classification
  • Xeroderma pigmentosum complementation groups
• VEGA ID
  OTTHUMG00000020330
• Locus Specific Databases
  • LRG_471

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products