Wnt7a Antibody

• Catalog number
  RP1088
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Wnt7a
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Wnt7a Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Wnt7a Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas – Rothschild / Schinzel phocomelia syndromes.
• Related articles
  1. Dang Y, Qin Y, Tang R, Mu Y, Li G, Xia M, Chen ZJ. “Variants of the WNT7A gene in Chinese patients with müllerian duct abnormalities.” Fertil Steril, 2012 Feb. 2. Kondratov AG, Kvasha SM, Stoliar LA, Romanenko AM, Zgonnyk YM, Gordiyuk VV, Kashuba EV, Rynditch AV, Zabarovsky ER, Kashuba VI. “Alterations of the WNT7A gene in clear cell renal cell carcinomas.” PLoS One, 2012.
• Gene Name
  WNT7A
• Protein Name
  Protein Wnt-7a
• Gene Full Name
  wingless-type MMTV integration site family, member 7A
• Synonyms
  Protein Wnt-7a antibody|Protein Wnt-7a precursor antibody|Proto oncogene Wnt7a protein antibody|proto-oncogene wnt7a protein antibody| wingless-type MMTV integration site family, member 7A antibody|WNT7A antibody|WNT7A_HUMAN antibody
• Uniprot ID
  O00755
• Entrez GeneID
  7476
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Wnt7a  
• Gene symbol
  WNT7A
• Short name
  Wnt7a Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  wingless-classification MMTV integration site family, member 7A (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  wingless-type MMTV integration site family, member 7A, WNT7A and IDBG-19862 and ENSG00000154764 and 7476, receptor a this GO nist activity, Extracellular, Wnt7a and IDBG-170090 and ENSMUSG00000030093 and 22421, WNT7A and IDBG-646453 and ENSBTAG00000001668 and 533782

Gene info

• Identity
  HGNC:12786
• Gene
  WNT7A
• Long gene name
  Wnt family member 7A
• Synonyms gene name
  • wingless-type MMTV integration site family, member 7A
• Synonyms
  • Wnt-7a
• Synonyms name
  • proto-oncogene Wnt7a protein
• GenBank acession
  • D83175
• Locus
  3p25.1
• Discovery year
  1996-03-12
• Entrez gene record
  7476
• Pubmed identfication
  • 8893824
  • 9161407
• RefSeq identity
  • NM_004625
• Classification
  • Wnt family
• VEGA ID
  OTTHUMG00000129803

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products