-
Target antigen
UHRF1
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UHRF1 (14-51aa HTVDSLSRLTKVEELRRKIQELFHVEPGLQRLFYRGKQ), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the UHRF1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The UHRF1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Ubiquitin-like, containing PHD and RING finger domains, 1 is a protein which in humans is encoded by the UHRF1 gene. This gene encodes a member of a subfamily of RING-finger type E3 ubiquitin ligases. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. It is regarded as a hub protein for the integration of epigenetic information. This gene is up-regulated in various cancers, and it is therefore considered to be a therapeutic target. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene exists on chromosome 12.
-
Related articles
1. "Entrez Gene: UHRF1 ubiquitin-like, containing PHD and RING finger domains, 1". 2. Hopfner R, Mousli M, Jeltsch JM, Voulgaris A, Lutz Y, Marin C, Bellocq JP, Oudet P, Bronner C (Jan 2000)."ICBP90, a novel human CCAAT binding protein, involved in the regulation of topoisomerase IIalpha expression".Cancer Research 60 (1): 121–8.
-
Gene Name
UHRF1
-
Protein Name
E3 ubiquitin-protein ligase UHRF1
-
Gene Full Name
ubiquitin-like with PHD and ring finger domains 1
-
Synonyms
Ac2-121 antibody|AL022808 antibody|E3 ubiquitin-protein ligase UHRF1 antibody|EC 6.3.2.- antibody|FLJ21925 antibody|hNP95 antibody| hUHRF1 antibody|HuNp95 antibody|ICBP90 antibody|Inverted CCAAT box binding protein of 90 kDa antibody|Inverted CCAAT box binding protein, 90-kD antibody|Inverted CCAAT box-binding protein of 90 kDa antibody|Liver regeneration-related protein LRRG126 antibody| MGC138707 antibody|NP95 antibody|Nuclear phosphoprotein, 95-KD antibody|Nuclear protein 95 antibody|Nuclear zinc finger protein Np95 antibody|RING finger protein 106 antibody|RNF106 antibody|Transcription factor ICBP90 antibody|Ubiquitin like containing PHD and RING finger domains protein 1 antibody|Ubiquitin like PHD and RING finger domain containing protein 1 antibody|Ubiquitin-like PHD and RING finger domain-containing protein 1 antibody|Ubiquitin-like protein containing PHD and RING finger domains 1 antibody|Ubiquitin-like with PHD and ring finger domains 1 antibody|Ubiquitin-like, containing PHD and RING finger domains, 1 antibody|Ubiquitin-like-containing PHD and RING finger domains protein 1 antibody|UHRF1 antibody|UHRF1_HUMAN antibody
-
Uniprot ID
Q96T88
-
Entrez GeneID
29128
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
