-
Target antigen
UBE2Q2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human UBE2Q2 (83-123aa LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ), different from the related mouse sequence by four amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the UBE2Q2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The UBE2Q2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
UBE2Q2 is identified as a putative ubiquitin-conjugating enzyme (E2) in a microarray screen for mitotic regulatory proteins. Its gene is mapped to 15q24.2. UBE2Q2 can covalently bind ubiquitin on the active site cysteine within the UBC domain. Inhibition of UBE2Q2 in HeLa cells causes an early mitotic arrest and increases cytotoxicity when the cells are treated with microtubule-inhibiting agents (MIAs). Changes in cell cycle progression and viability are not observed in the absence of MIA treatment, indicating that UBE2Q2 is involved in the response to MIAs rather than performing a more general function in mitosis. Moreover, inhibition of the UBE2Q2 protein causes cells to undergo a prolonged prophase arrest, suggesting that UBE2Q2 normally functions to antagonize an early mitotic checkpoint. Finally, inhibition of UBE2Q2 also sensitizes cells to the cytotoxic effects of MIAs through caspase-mediated apoptosis that is correlated with PARP1 cleavage.
-
Related articles
1. Banerjee, S., Brooks, W. S., Crawford, D. F. Inactivation of the ubiquitin conjugating enzyme UBE2Q2 causes a prophase arrest and enhanced apoptosis in response to microtubule inhibiting agents. Oncogene 26: 6509-6517, 2007. 2. Crawford, D. F., Piwnica-Worms, H. The G2 DNA damage checkpoint delays expression of genes encoding mitotic regulators. J. Biol. Chem. 276: 37166-37177, 2001. 3. Seghatoleslam, A., Zambrano, A., Millon, R., Ganguli, G., Argentini, M., Cromer, A., Abecassis, J., Wasylyk, B. Analysis of a novel human gene, LOC92912, over-expressed in hypopharyngeal tumours. Biochem. Biophys. Res. Commun. 339: 422-429, 2006.
-
Gene Name
UBE2Q2
-
Protein Name
Ubiquitin-conjugating enzyme E2 Q2
-
Gene Full Name
ubiquitin conjugating enzyme E2Q family member 2
-
Synonyms
LOC92912 antibody|UB2Q2_HUMAN antibody|UBE2Q2 antibody|Ubiquitin carrier protein Q2 antibody|Ubiquitin conjugating enzyme E2Q 2 antibody|Ubiquitin conjugating enzyme E2Q family member 2 antibody|Ubiquitin-conjugating enzyme E2 Q2 antibody|ubiquitin-conjugating enzyme E2Q (putative) 2 antibody|Ubiquitin-protein ligase Q2 antibody
-
Uniprot ID
Q8WVN8
-
Entrez GeneID
92912
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
