-
Target antigen
UBE1C
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human UBE1C (409-448aa KNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVAD), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the UBE1C Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The UBE1C Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
NEDD8-activating enzyme E1 catalytic subunit is a protein that in humans is encoded by the UBA3 gene. The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, an ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
-
Related articles
1. "Entrez Gene: UBE1C ubiquitin-activating enzyme E1C (UBA3 homolog, yeast)". 2. Bohnsack, R. N., Haas, A. L. Conservation in the mechanism of Nedd8 activation by the human AppBp1-Uba3 heterodimer. J. Biol. Chem. 278: 26823-26830, 2003. 3. Osaka F, Kawasaki H, Aida N, Saeki M, Chiba T, Kawashima S, Tanaka K, Kato S (August 1998). "A new NEDD8-ligating system for cullin-4A". Genes Dev 12 (15): 2263–8.
-
Gene Name
UBA3
-
Protein Name
NEDD8-activating enzyme E1 catalytic subunit
-
Gene Full Name
ubiquitin-like modifier activating enzyme 3
-
Synonyms
DKFZp566J164 antibody|EC 6.3.2. antibody|hUba3 antibody|MGC22384 antibody|NEDD8 activating enzyme E1 catalytic subunit antibody|NEDD8 activating enzyme E1C antibody|Nedd8 activating enzyme hUba3 antibody|NEDD8-activating enzyme E1 catalytic subunit antibody|NEDD8-activating enzyme E1C antibody|uba3 antibody|UBA3 ubiquitin activating enzyme E1 homolog antibody|UBA3_HUMAN antibody|UBE1C antibody| Ubiquitin activating enzyme 3 antibody|Ubiquitin activating enzyme E1C antibody|Ubiquitin-activating enzyme 3 antibody|Ubiquitin-activating enzyme E1C antibody|Ubiquitin-like modifier-activating enzyme 3 antibody
-
Uniprot ID
Q8TBC4
-
Entrez GeneID
9039
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
