TRPM1 Antibody

  • Catalog number
    A03565-1
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    TRPM1
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human TRPM1 (27-62aa KNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLEFQ), different from the related mouse sequence by eleven amino acids, and from the related rat sequence by twelve amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the TRPM1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The TRPM1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Transient receptor potential cation channel subfamily M member 1 is a protein that in humans is encoded by the TRPM1 gene. This gene encodes a member of the transient receptor potential melastatin subfamily of transient receptor potential ion channels. The encoded protein is a calcium permeable cation channel that is expressed in melanocytes and may play a role in melanin synthesis. Specific mutations in this gene are the cause autosomal recessive complete congenital stationary night blindness-1C. The expression of this protein is inversely correlated with melanoma aggressiveness and as such it is used as a prognostic marker for melanoma metastasis. Alternate splicing results in multiple transcript variants.
  • Related articles
    1. Clapham DE, Julius D, Montell C, Schultz G (Dec 2005). "International Union of Pharmacology. XLIX. Nomenclature and structure-function relationships of transient receptor potential channels".Pharmacological Reviews. 57 (4): 427–50. 2. Duncan LM, Deeds J, Hunter J, Shao J, Holmgren LM, Woolf EA, Tepper RI, Shyjan AW (Apr 1998). "Down-regulation of the novel gene melastatin correlates with potential for melanoma metastasis". Cancer Research. 58 (7): 1515–20. 3. Hunter JJ, Shao J, Smutko JS, Dussault BJ, Nagle DL, Woolf EA, Holmgren LM, Moore KJ, Shyjan AW (Nov 1998). "Chromosomal localization and genomic characterization of the mouse melastatin gene (Mlsn1)".Genomics. 54 (1): 116–23.
  • Gene Name
    TRPM1
  • Protein Name
    Transient receptor potential cation channel subfamily M member 1
  • Gene Full Name
    transient receptor potential cation channel subfamily M member 1
  • Synonyms
    MLSN1 | CSNB1C | LTRPC1 | Q7Z4N2
  • Uniprot ID
    Q7Z4N2
  • Entrez GeneID
    4308
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    TRPM1  
  • Gene symbol
    TRPM1
  • Short name
    TRPM1 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    TRPM1 (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    transient receptor potential cation channel subfamily M member 1
  • Synonyms gene
  • Synonyms gene name
    • melastatin 1
    • transient receptor potential cation channel, subfamily M, member 1
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1998-05-26
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Transient receptor potential cation channels
    • MicroRNA protein coding host genes
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee