TMEM107 Antibody

• Catalog number
  A04966
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  TMEM107
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human TMEM107 (22-57aa VITLFWSRDSNIQACLPLTFTPEEYDKQDIQLVAAL), different from the related mouse and rat sequences by four amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the TMEM107 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The TMEM107 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Cilia are dynamic signaling organelles essential for developmental patterning, including left-right specification, skeletal formation, neural development, and organogenesis. TMEM107 is predicted to be critical for cilia formation and signaling in a subset of embryonic tissues. Based on an alignment of theTMEM107 sequence with the genomic sequence (GRCh38), the TMEM107 gene was mapped to chromosome 17p13.1.
• Related articles
  1. Christopher, K. J., Wang, B., Kong, Y., Weatherbee, S. D. Forward genetics uncovers transmembrane protein 107 as a novel factor required for ciliogenesis and Sonic hedgehog signaling. Dev. Biol. 368: 382-392, 2012. 2. Hartz, P. A. Personal Communication. Baltimore, Md. 1/12/2015.
• Gene Name
  TMEM107
• Protein Name
  Transmembrane protein 107
• Gene Full Name
  transmembrane protein 107
• Synonyms
  DC20 | GRVS638 | PRO1268 | Tmem107 | UNQ638/PRO1268 | Q6UX40
• Uniprot ID
  Q6UX40
• Entrez GeneID
  84314
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  TMEM107  
• Gene symbol
  TMEM107
• Short name
  TMEM107 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  TMEM107 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:28128
• Gene
  TMEM107
• Long gene name
  transmembrane protein 107
• Synonyms
  • MGC10744
  • JBTS29
  • MKS13
• GenBank acession
  • AF311338
• Locus
  17p13.1
• Discovery year
  2005-12-19
• Entrez gene record
  84314
• Pubmed identfication
  • 22698544
  • 26123494
  • 26518474
• RefSeq identity
  • NM_032354
• VEGA ID
  OTTHUMG00000166276

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products