TIM 1 Antibody
-
Catalog numberRP1093
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenTIM 1
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human TIM 1 (321-359aa QQLSVSFSSLQIKALQNAVEKEVQAEDNIYIENSLYATD).
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the TIM 1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe TIM 1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundKIM1 (KIDNEY INJURY MOLECULE 1), also known as HAVCR1, HAVCR or TIM1, is a protein that in humans is encoded by the KIM1 gene. The KIM1 gene is mapped to 5q33.3. Biochemical, mutational, and cell adhesion analyses confirm that Tim1 is capable of homophilic Tim-Tim interactions. The features identified in murine KIM1 are conserved in human KIM1. The KIM1 protein is indeed a receptor for the virus through the infection of canine osteogenic sarcoma cells expressing HAVCR1 with HAV. Using a monoclonal antibody to mouse Tim1, Tim1 is expressed after activation of naive T cells and on T cells differentiated in Th2-polarizing conditions. Ectopic expression of KIM1 during mouse T-cell differentiation leads to production of the Th2-type cytokine Il4, but not the Th1-type cytokine Ifng. KIM1-expressing epithelial cells internalized apoptotic bodies, and Kim1 is directly responsible for phagocytosis in cultured primary rat tubule epithelial cells and in porcine and canine epithelial cell lines.
-
Related articles1. de Souza, A. J., Oriss, T. B., O'Malley, K. J., Ray, A., Kane, L. P. T cell Ig and mucin 1 (TIM-1) is expressed on in vivo-activated T cells and provides a costimulatory signal for T cell activation. Proc. Nat. Acad. Sci. 102: 17113-17118, 2005. 2. Feigelstock, D., Thompson, P., Mattoo, P., Zhang, Y., Kaplan, G. G. The human homolog of HAVcr-1 codes for a hepatitis A virus cellular receptor. J. Virol. 72: 6621-6628, 1998.
-
Gene NameHAVCR1
-
Protein NameHepatitis A virus cellular receptor 1(HAVcr-1)
-
Gene Full Namehepatitis A virus cellular receptor 1
-
SynonymsHAVCR 1 antibody|HAVcr-1 antibody|HAVCR1 antibody|Hepatitis A virus cellular receptor 1 antibody|Kidney injury molecule 1 antibody|KIM 1 antibody|KIM-1 antibody|T cell immunoglobin domain and mucin domain protein 1 antibody|T-cell immunoglobulin and mucin domain-containing protein 1 antibody|T-cell membrane protein 1 antibody|TIM antibody|TIM-1 antibody|TIM1 antibody|TIMD 1 antibody|TIMD-1 antibody|TIMD1 antibody|TIMD1_HUMAN antibody
-
Uniprot IDQ96D42
-
Entrez GeneID26762
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolTIMELESS, ARHGEF5, HAVCR2, HAVCR1
-
Short nameTIM 1 Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameTIM 1 (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nametimeless circadian regulator
-
Synonyms gene name
- timeless (Drosophila) homolog
- timeless homolog (Drosophila)
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-01-08
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameRho guanine nucleotide exchange factor 5
-
Synonyms gene name
- Rho guanine nucleotide exchange factor (GEF) 5
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2001-02-15
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Dbl family Rho GEFs
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namehepatitis A virus cellular receptor 2
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-12-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- V-set domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namehepatitis A virus cellular receptor 1
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year2002-12-04
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- CD molecules
- V-set domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
