-
Target antigen
STXBP2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human STXBP2 (184-215aa QEYPAIRYRKGPEDTAQLAHAVLAKLNAFKAD), different from the related mouse and rat sequences by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the STXBP2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The STXBP2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Syntaxin-binding protein 2, also known as UNC18B, is a protein that in humans is encoded by the STXBP2 gene. The STXBP2 gene is mapped to human chromosome 19p13.3-p13.2 and to the proximal arm of mouse chromosome 8. And this gene encodes a member of the STXBP/unc-18/SEC1 family. The encoded protein is involved in intracellular trafficking, control of SNARE (soluble NSF attachment protein receptor) complex assembly, and the release of cytotoxic granules by natural killer cells. Additionally, UNC18B is expressed predominantly as a 2.4-kb message in placenta, lung, liver, kidney, and pancreas, as well as in peripheral blood lymphocytes. Mutations in this gene are associated with familial hemophagocytic lymphohistiocytosis. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
-
Related articles
1. "Entrez Gene: STXBP2 syntaxin binding protein 2". 2. Cetica, V., Santoro, A., Gilmour, K. C., Sieni, E., Beutel, K., Pende, D., Marcenaro, S., Koch, F., Grieve, S., Wheeler, R., Zhao, F., zur Stadt, U., Griffiths, G. M., Arico, M. STXBP2 mutations in children with familial haemophagocytic lymphohistiocytosis type 5. J. Med. Genet. 47: 595-600, 2010. 3. Ziegler, S.F., Mortrud, M. T., Swartz, A. R., Baker, E., Sutherland, G. R., Burmeister, M., Mulligan, J. T. Molecular characterization of a nonneuronal human UNC18 homolog. Genomics 37: 19-23, 1996.
-
Gene Name
STXBP2
-
Protein Name
Syntaxin-binding protein 2
-
Gene Full Name
syntaxin binding protein 2
-
Synonyms
FHL5 antibody|Hunc18b antibody|MUNC18 2 antibody|pp10122 antibody|Protein unc-18 homolog 2 antibody|Protein unc-18 homolog B antibody| STXB2_HUMAN antibody|Stxbp2 antibody|syntaxin binding protein 2 antibody|Syntaxin-binding protein 2 antibody|Unc-18B antibody|UNC18 2 antibody|Unc18-2 antibody|UNC18B antibody
-
Uniprot ID
Q15833
-
Entrez GeneID
6813
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
