Sp5 Antibody

• Catalog number
  PB9443
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Sp5
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence in the middle region of human Sp5 (246-275aa DFAQYQSQIAALLQTKAPLAATARRCRRCR), identical to the related mouse sequence.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Sp5 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Sp5 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.
• Related articles
  1. Chen Y; Guo Y; Ge X; Itoh H; Watanabe A; Fujiwara T; Kodama T; Aburatani H: Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers. Biochem Biophys Res Commun, 2006 Feb 17. 2. Simmons SO; Horowitz JM: Nkx3.1 binds and negatively regulates the transcriptional activity of Sp-family members in prostate-derived cells. Biochem J, 2006 Jan 1.
• Gene Name
  SP5
• Protein Name
  Transcription factor Sp5
• Gene Full Name
  Sp5 transcription factor
• Synonyms
  Transcription factor Sp5 antibody
• Uniprot ID
  Q6BEB4
• Entrez GeneID
  389058
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Sp5  
• Gene symbol
  SP5
• Short name
  Sp5 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Sp5 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:14529
• Gene
  SP5
• Long gene name
  Sp5 transcription factor
• Locus
  2q31.1
• Discovery year
  2004-06-09
• Entrez gene record
  389058
• RefSeq identity
  • NM_001003845
• Classification
  • Sp transcription factors
  • Zinc fingers C2H2-type
• VEGA ID
  OTTHUMG00000154053

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products