SMYD3 Antibody

• Catalog number
  PB9893
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  SMYD3
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS), different from the related mouse sequence by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the SMYD3 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The SMYD3 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  SET and MYND domain-containing protein 3 is a protein that in humans is encoded by the SMYD3 gene. The International Radiation Hybrid Mapping Consortium mapped the SMYD3 gene to chromosome 1. This gene encodes a histone methyltransferase which functions in RNA polymerase II complexes by an interaction with a specific RNA helicase. Multiple transcript variants encoding different isoforms have been found for this gene.
• Related articles
  1. Hamamoto, R., Furukawa, Y., Morita, M., Iimura, Y., Silva, F. P., Li, M., Yagyu, R., Nakamura, Y. SMYD3 encodes a histone methyltransferase involved in the proliferation of cancer cells. Nature Cell Biol. 6: 731-740, 2004. 2. Mazur, P. K., Reynoird, N., Khatri, P., Jansen, P. W. T. C., Wilkinson, A. W., Liu, S., Barbash, O., Van Aller, G. S., Huddleston, M., Dhanak, D., Tummino, P. J., Kruger, R. G., Garcia, B. A., Butte, A. J., Vermeulen, M., Sage, J., Gozani, O. SMYD3 links lysine methylation of MAP3K2 to Ras-driven cancer. Nature 510: 283-287, 2014. 3. Tsuge, M., Hamamoto, R., Silva, F. P., Ohnishi, Y., Chayama, K., Kamatani, N., Furukawa, Y., Nakamura, Y. A variable number of tandem repeats polymorphism in an E2F-1 binding element in the 5-prime flanking region of SMYD3 is a risk factor for human cancers. Nature Genet. 37: 1104-1107, 2005.
• Gene Name
  SMYD3
• Protein Name
  Histone-lysine N-methyltransferase SMYD3
• Gene Full Name
  SET and MYND domain containing 3
• Synonyms
  bA74P14.1 (novel protein) antibody|bA74P14.1 antibody|FLJ21080 antibody|histone lysine N methyltransferase SMYD3 antibody|KMT3E antibody|MGC104324 antibody|SET and MYND domain containing 3 antibody|SET and MYND domain containing protein 3 antibody|SET and MYND domain-containing protein 3 antibody|SMYD 3 antibody|Smyd3 antibody|SMYD3 protein antibody|SMYD3_HUMAN antibody|Zinc finger MYND domain containing 1 antibody|Zinc finger MYND domain containing protein 1 antibody|Zinc finger MYND domain-containing protein 1 antibody|Zinc finger protein subfamily 3A MYND domain containing 1 antibody|Zinc finger protein, subfamily 3A (MYND domain containing), 1 antibody|ZMYND 1 antibody|ZMYND1 antibody|ZNFN3A1 antibody
• Uniprot ID
  Q9H7B4
• Entrez GeneID
  64754
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  SMYD3  
• Gene symbol
  SMYD3-AS1, SMYD3-IT1, SMYD3
• Short name
  SMYD3 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  SMYD3 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:40708
• Gene
  SMYD3-AS1
• Long gene name
  SMYD3 antisense RNA 1
• Locus
  1q44
• Discovery year
  2020-03-27
• Entrez gene record
  101928089
• Classification
  • Antisense RNAs

Gene info

• Identity
  HGNC:41406
• Gene
  SMYD3-IT1
• Long gene name
  SMYD3 intronic transcript 1
• Synonyms gene name
  • SMYD3 intronic transcript 1 (non-protein coding)
• Locus
  1q44
• Discovery year
  2011-08-23
• Classification
  • Intronic transcripts
• VEGA ID
  OTTHUMG00000040509

Gene info

• Identity
  HGNC:15513
• Gene
  SMYD3
• Long gene name
  SET and MYND domain containing 3
• Synonyms gene
  • ZNFN3A1
  • ZMYND1
• Synonyms gene name
  • zinc finger, MYND domain containing 1
• Synonyms
  • KMT3E
• GenBank acession
  • AK023594
• Locus
  1q44
• Discovery year
  2001-04-06
• Entrez gene record
  64754
• RefSeq identity
  • NM_022743
• Classification
  • SET domain containing
  • Lysine methyltransferases
  • Zinc fingers MYND-type
• VEGA ID
  OTTHUMG00000040508

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products