Periplakin Antibody
-
Catalog numberA02098-1
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenPeriplakin
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Periplakin (1664-1701aa DTGRELSPEEAHRAGLIDWNMFVKLRSQECDWEEISVK), different from the related mouse sequence by one amino acid.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the Periplakin Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe Periplakin Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundPeriplakin is a protein that in humans is encoded by the PPL gene. The protein encoded by this gene is a component of desmosomes and of the epidermal cornified envelope in keratinocytes. The N-terminal domain of this protein interacts with the plasma membrane and its C-terminus interacts with intermediate filaments. Through its rod domain, this protein forms complexes with envoplakin. This protein may serve as a link between the cornified envelope and desmosomes as well as intermediate filaments. AKT1/PKB, a protein kinase mediating a variety of cell growth and survival signaling processes, is reported to interact with this protein, suggesting a possible role for this protein as a localization signal in AKT1-mediated signaling.
-
Related articles1. "Entrez Gene: PPL periplakin". 2. Aho S, McLean WH, Li K, Uitto J (Jun 1998). "cDNA cloning, mRNA expression, and chromosomal mapping of human and mouse periplakin genes". Genomics. 48 (2): 242–7. 3. Kazerounian, Shideh; Uitto Jouni; Aho Sirpa (Oct 2002). "Unique role for the periplakin tail in intermediate filament association: specific binding to keratin 8 and vimentin". Exp. Dermatol. Denmark. 11(5): 428–38.
-
Gene NamePPL
-
Protein NamePeriplakin
-
Gene Full Nameperiplakin
-
SynonymsPeriplakin | ppl | O60437
-
Uniprot IDO60437
-
Entrez GeneID5493
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolPPL, KAZN
-
Short namePeriplakin Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative namePeriplakin (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene nameperiplakin
-
GenBank acession
-
Locus
-
Discovery year1997-08-22
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Plakins
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namekazrin, periplakin interacting protein
-
Synonyms gene
-
Synonyms gene name
- chromosome 1 open reading frame 196
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2011-01-31
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Sterile alpha motif domain containing
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data