-
Target antigen
Parvin alpha
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Parvin alpha (155-185aa QKLQTVLEKINETLKLPPRSIKWNVDSVHAK), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Parvin alpha Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Parvin alpha Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.
-
Related articles
1. "Entrez Gene: PARVA parvin, alpha". 2. Olski TM, Noegel AA, Korenbaum E (Feb 2001). "Parvin, a 42 kDa focal adhesion protein, related to the alpha-actinin superfamily". J Cell Sci 114 (Pt 3): 525–38. 3. Zhang Y, Chen K, Tu Y, Wu C (2004). "Distinct roles of two structurally closely related focal adhesion proteins, alpha-parvins and beta-parvins, in regulation of cell morphology and survival.". J. Biol. Chem. 279 (40): 41695–705.
-
Gene Name
PARVA
-
Protein Name
Alpha-parvin
-
Gene Full Name
parvin, alpha
-
Synonyms
Actopaxin antibody|Alpha parvin antibody|Alpha-parvin antibody|Calponin like integrin linked kinase binding protein antibody|Calponin-like integrin-linked kinase-binding protein antibody|CH ILKBP antibody|CH-ILKBP antibody|FLJ10793 antibody|FLJ12254 antibody|Matrix remodelling associated 2 antibody|Matrix remodelling associated protein 2 antibody|Matrix-remodeling-associated protein 2 antibody|MXRA 2 antibody|MXRA2 antibody|PARV A antibody| PARVA antibody|PARVA_HUMAN antibody
-
Uniprot ID
Q9NVD7
-
Entrez GeneID
55742
-
Description
The Parvin alpha Antibody is a α- or alpha protein sometimes glycoprotein present in blood.
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
