-
Target antigen
nmt55/p54nrb
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
mouse, rat Theoretical reactivity:human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human nmt55/p54nrb (1-35aa MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQ), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the nmt55/p54nrb Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The nmt55/p54nrb Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Non-POU domain-containing octamer-binding protein is a protein that in humans is encoded by the NONO gene. This gene encodes an RNA-binding protein which plays various roles in the nucleus, including transcriptional regulation and RNA splicing. A rearrangement between this gene and the transcription factor E3 gene has been observed in papillary renal cell carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes exist on Chromosomes 2 and 16.
-
Related articles
1. "Entrez Gene: NONO Non-POU domain containing, octamer-binding". 2. Dong B, Horowitz DS, Kobayashi R, Krainer AR (Oct 1993). "Purification and cDNA cloning of HeLa cell p54nrb, a nuclear protein with two RNA recognition motifs and extensive homology to human splicing factor PSF and Drosophila NONA/BJ6". Nucleic Acids Res. 21 (17): 4085–92. 3. Traish AM, Huang YH, Ashba J, Pronovost M, Pavao M, McAneny DB, Moreland RB (Dec 1997). "Loss of expression of a 55 kDa nuclear protein (nmt55) in estrogen receptor-negative human breast cancer". Diagn. Mol. Pathol. 6(4): 209–21.
-
Gene Name
NONO
-
Protein Name
Non-POU domain-containing octamer-binding protein
-
Gene Full Name
non-POU domain containing, octamer-binding
-
Synonyms
52 kDa subunit antibody|54 kDa nuclear RNA and DNA binding protein antibody|54 kDa nuclear RNA- and DNA-binding protein antibody|55 kDa nuclear protein antibody|DNA binding p52/p100 complex 52 kDa subunit antibody|DNA-binding p52/p100 complex antibody|NMT 55 antibody|NMT55 antibody|Non Pou domain containing octamer (ATGCAAAT) binding protein antibody|Non POU domain containing octamer binding antibody|Non POU domain containing octamer binding protein antibody|Non-POU domain-containing octamer-binding protein antibody|Nono antibody|NonO protein antibody|NONO_HUMAN antibody|NRB 54 antibody|NRB antibody|NRB54 antibody|Nuclear RNA binding protein 54kD antibody|P54 antibody|p54(nrb) antibody|p54nrb antibody|PPP1R114 antibody|Protein phosphatase 1 regulatory subunit 114 antibody
-
Uniprot ID
Q15233
-
Entrez GeneID
4841
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
