Neuroserpin Antibody

• Catalog number
  PB9744
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Neuroserpin
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  mouse, rat Theoretical reactivity:human
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human Neuroserpin (272-310aa KAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKA L), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Neuroserpin Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Neuroserpin Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Neuroserpin is a protein that in humans is encoded by the SERPINI1 gene. This gene encodes a member of the serpin superfamily of serine proteinase inhibitors. The protein is primarily secreted by axons in the brain, and preferentially reacts with and inhibits tissue-type plasminogen activator. It is thought to play a role in the regulation of axonal growth and the development of synaptic plasticity. Mutations in this gene result in familial encephalopathy with neuroserpin inclusion bodies (FENIB), which is a dominantly inherited form of familial encephalopathy and epilepsy characterized by the accumulation of mutant neuroserpin polymers. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Related articles
  1. "Entrez Gene: SERPINI1 serpin peptidase inhibitor, clade I (neuroserpin), member 1". 2. Yepes M, Lawrence DA (2004). "Neuroserpin: a selective inhibitor of tissue-type plasminogen activator in the central nervous system.". Thromb. Haemost. 91 (3): 457–64.
• Gene Name
  SERPINI1
• Protein Name
  Neuroserpin
• Gene Full Name
  serpin peptidase inhibitor, clade I (neuroserpin), member 1
• Synonyms
  DKFZp781N13156 antibody|Neuroserpin antibody|NEUS_HUMAN antibody|Peptidase inhibitor 12 antibody|PI-12 antibody|PI12 antibody|Protease inhibitor 12 antibody|Serine or cysteine proteinase inhibitor clade I (neuroserpin) member 1 antibody|Serine or cysteine proteinase inhibitor clade I member 1 antibody|Serpin I1 antibody|Serpin peptidase inhibitor clade I (neuroserpin) member 1 antibody|SERPINI1 antibody
• Uniprot ID
  Q99574
• Entrez GeneID
  5274
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Neuroserpin  
• Gene symbol
  SERPINI1, SERPINI2
• Short name
  Neuroserpin Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Neuroserpin (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:8943
• Gene
  SERPINI1
• Long gene name
  serpin family I member 1
• Synonyms gene
  • PI12
• Synonyms gene name
  • serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1
• Synonyms name
  • neuroserpin
• GenBank acession
  • Z81326
• Locus
  3q26.1
• Discovery year
  1995-12-20
• Entrez gene record
  5274
• Pubmed identfication
  • 24172014
• Classification
  • Serpin peptidase inhibitors
• VEGA ID
  OTTHUMG00000158450

Gene info

• Identity
  HGNC:8945
• Gene
  SERPINI2
• Long gene name
  serpin family I member 2
• Synonyms gene
  • PI14
• Synonyms gene name
  • serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 2
  • serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2
  • serpin peptidase inhibitor, clade I (pancpin), member 2
• Synonyms
  • TSA2004
  • MEPI
• Synonyms name
  • myoepithelium-derived serine proteinase inhibitor
  • pancpin
• GenBank acession
  • AB006423
• Locus
  3q26.1
• Discovery year
  1995-12-20
• Entrez gene record
  5276
• Pubmed identfication
  • 9624529
  • 24172014
• RefSeq identity
  • NM_006217
• Classification
  • Serpin peptidase inhibitors
• VEGA ID
  OTTHUMG00000158231

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products