MUC3 Antibody

• Catalog number
  PB9955
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  MUC3
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human MUC3 (DLNDNTSQAYRDFNKTFWNQMQKIFADMQGFTFK).
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the MUC3 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The MUC3 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  MUC3 consists of two genes, MUC3A and MUC3B, each encoding membrane-bound mucins possessing 2 epidermal growth factor-like domains. The MUC3 gene is mapped to chromosome 7. It was showed that synthetic peptide-mediated upregulation of MUC3 dramatically inhibited adherence of enteropathogenic E. coli or enterohemorrhage E. coli serotype O157:H7 to HT-29 human intestinal epithelial cells. Peptide stimulation altered expression of a number of transcription factors, including upregulation of SP1, CREB1, and CDX2. These transcription factors bound to consensus sites in the MUC3 promoter upon peptide stimulation and likely mediated MUC3 upregulation.
• Related articles
  1. Fox, M., Lahbib, F., Pratt, W., Attwood, J., Gum, J., Kim, Y., Swallow, D. M. Regional localisation of MUC3 to chromosome 7q22. (Abstract) Cytogenet. Cell Genet. 58: 1920-1921, 1991. 2. Pan, Q., Tian, Y., Li, X., Ye, J., Liu, Y., Song, L., Yang, Y., Zhu, R., He, Y., Chen, L., Chen, W., Mao, X., Peng, Z., Wang, R. Enhanced membrane-tethered mucin 3 (MUC3) expression by a tetrameric branched peptide with a conserved TFLK motif inhibits bacteria adherence. J. Biol. Chem. 288: 5407-5416, 2013. 3. Williams, S. J., Munster, D. J., Quin, R. J., Gotley, D. C., McGuckin, M. A. The MUC3 gene encodes a transmembrane mucin and is alternatively spliced. Biochem. Biophys. Res. Commun. 261: 83-89, 1999.
• Gene Name
  MUC3A/MUC3B
• Protein Name
  Mucin-3A/Mucin-3B
• Gene Full Name
  mucin 3A, cell surface associated/mucin 3B, cell surface associated
• Synonyms
  MUC-3A | MUC3A | MUC 3A | Mucin 3A | MUC-3B | MUC3B | MUC 3B | MUC3 | Mucin 3 | Q02505 | Q9H195
• Uniprot ID
  Q02505/Q9H195
• Entrez GeneID
  4584/57876
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  MUC3  
• Gene symbol
  MUC3A
• Short name
  MUC3 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  MUC3 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:7513
• Gene
  MUC3A
• Long gene name
  mucin 3A, cell surface associated
• Synonyms gene
  • MUC3
• Synonyms gene name
  • mucin 3A, intestinal
• GenBank acession
  • AF113616
• Locus
  7q22.1
• Discovery year
  1990-02-27
• Entrez gene record
  4584
• Pubmed identfication
  • 2393399
  • 10973822
• RefSeq identity
  • NM_005960
• Classification
  • Mucins
• VEGA ID
  OTTHUMG00000157038

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products