Lysozyme Antibody
-
Catalog numberPB9663
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenLysozyme
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB,IHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the Lysozyme Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe Lysozyme Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundIn humans, the lysozyme enzyme is encoded by the LYZ gene. This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta [1-4] glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis.
-
Related articles1. McKenzie HA, White FH (1991). "Lysozyme and alpha-lactalbumin: structure, function, and interrelationships". Adv. Protein Chem. 41: 173–315. 2. Peters CW, Kruse U, Pollwein R, Grzeschik KH, Sippel AE (July 1989). "The human lysozyme gene. Sequence organization and chromosomal localization". Eur. J. Biochem. 182 (3): 507–16. 3. Yoshimura K, Toibana A, Nakahama K (January 1988). "Human lysozyme: sequencing of a cDNA, and expression and secretion by Saccharomyces cerevisiae". Biochem. Biophys. Res. Commun. 150 (2): 794–801.
-
Gene NameLYZ
-
Protein NameLysozyme C
-
Gene Full Namelysozyme
-
Synonyms1 4 beta n acetylmuramidase c antibody|1 antibody|4-beta-N-acetylmuramidase C antibody|EC 3.2.1.17 antibody|LYSC_HUMAN antibody| Lysosyme antibody|Lysozyme (renal amyloidosis) antibody|Lysozyme C antibody|Lysozyme C precursor antibody|Lyz antibody|LZM antibody| Renal amyloidosis antibody
-
Uniprot IDP61626
-
Entrez GeneID4069
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolLYZL4, LYZ, LYZL2
-
Short nameLysozyme Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameLysozyme (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namelysozyme like 4
-
Synonyms gene name
- lysozyme-like 4
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2004-08-02
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Lysozymes, c-type
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namelysozyme
-
Synonyms gene name
- lysozyme (renal amyloidosis)
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1989-05-25
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- Lysozymes, c-type
-
VEGA ID
-
Locus Specific Databases
Gene info
-
Identity
-
Gene
-
Long gene namelysozyme like 2
-
Synonyms gene name
- lysozyme-like 2
-
GenBank acession
-
Locus
-
Discovery year2004-05-27
-
Entrez gene record
-
RefSeq identity
-
Classification
- Lysozymes, c-type
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data