-
Target antigen
KCNA3
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human KCNA3 (513-544aa EELRKARSNSTLSKSEYMVIEEGGMNHSAFPQ), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the KCNA3 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The KCNA3 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Potassium voltage-gated channel, shaker-related subfamily, member 3, also known as KCNA3 or Kv1.3, is a protein that in humans is encoded by the KCNA3 gene. This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. This member contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. It belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. It plays an essential role in T-cell proliferation and activation. This gene appears to be intronless and it is clustered together with KCNA2 and KCNA10 genes on chromosome 1. And Kv1.3 has been reported to be expressed in the inner mitochondrial membrane in lymphocytes. The apoptotic protein Bax has been suggested to insert into theouter mitochondrial membrane and occlude the pore of Kv1.3 via a lysine residue. Thus, Kv1.3 modulation may be one of many mechanisms that contribute to apoptosis.
-
Related articles
1. Szabó I, Bock J, Grassmé H, Soddemann M, Wilker B, Lang F, Zoratti M, Gulbins E (September 2008). "Mitochondrial potassium channel Kv1.3 mediates Bax-induced apoptosis in lymphocytes". Proc. Natl. Acad. Sci. U.S.A. 105 (39): 14861–6. 2. Storey NM, Gómez-Angelats M, Bortner CD, Armstrong DL, Cidlowski JA (August 2003). "Stimulation of Kv1.3 potassium channels by death receptors during apoptosis in Jurkat T lymphocytes". J. Biol. Chem. 278 (35): 33319–26.
-
Gene Name
KCNA3
-
Protein Name
Potassium voltage-gated channel subfamily A member 3
-
Gene Full Name
potassium channel, voltage gated shaker related subfamily A, member 3
-
Synonyms
HGK 5 antibody|HGK5 antibody|HLK 3 antibody|HLK3 antibody|HPCN 3 antibody|HPCN3 antibody|HuKIII antibody|KCNA 3 antibody|Kcna3 antibody|KCNA3_HUMAN antibody|KV1.3 antibody|MK 3 antibody|MK3 antibody|OTTHUMP00000032397 antibody|PCN 3 antibody|PCN3 antibody| Potassium channel 3 antibody|Potassium voltage gated channel shaker related subfamily member 3 antibody|Potassium voltage gated channel subfamily A member 3 antibody|Potassium voltage-gated channel subfamily A member 3 antibody|Type n potassium channel antibody| Voltage gated potassium channel protein Kv1.3 antibody|Voltage gated potassium channel subunit Kv1.3 antibody|Voltage-gated K(+) channel HuKIII antibody|Voltage-gated potassium channel subunit Kv1.3 antibody
-
Uniprot ID
P22001
-
Entrez GeneID
3738
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
