-
Target antigen
Hsp90 beta
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 beta (449-481aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Hsp90 beta Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Hsp90 beta Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Heat shock protein HSP 90-beta, also called HSP90beta, is a protein that in humans is encoded by the HSP90AB1 gene. It is mapped to chromosome 6p21.1. This gene encodes a member of the heat shock protein 90 family; these proteins are involved in signal transduction, protein folding and degradation and morphological evolution. And this gene is thought to play a role in gastric apoptosis and inflammation. Alternative splicing results in multiple transcript variants. Pseudogenes have been identified on multiple chromosomes.
-
Related articles
1. "Entrez Gene: HSP90AB1 Heat shock protein 90kDa alpha (cytosolic), class B member 1". 2. Chen B, Piel WH, Gui L, Bruford E, Monteiro A (Dec 2005). "The HSP90 family of genes in the human genome: insights into their divergence and evolution". Genomics 86 (6): 627–37. 3. Rebbe NF, Hickman WS, Ley TJ, Stafford DW, Hickman S (Sep 1989). "Nucleotide sequence and regulation of a human 90-kDa heat shock protein gene". The Journal of Biological Chemistry 264 (25): 15006–11.
-
Gene Name
HSP90AB1
-
Protein Name
Heat shock protein HSP 90-beta
-
Gene Full Name
heat shock protein 90kDa alpha (cytosolic), class B member 1
-
Synonyms
90 kda heat shock protein beta HSP90 beta antibody|D6S182 antibody|FLJ26984 antibody|Heat shock 84 kDa antibody|Heat shock 90kD protein 1, beta antibody|Heat shock 90kDa protein 1 beta antibody|Heat shock protein 90kDa alpha (cytosolic) class B member 1 antibody|Heat shock protein beta antibody|Heat shock protein HSP 90 beta antibody|Heat shock protein HSP 90-beta antibody|HS90B_HUMAN antibody|HSP 84 antibody|HSP 90 antibody|HSP 90 b antibody|HSP 90b antibody|HSP84 antibody|HSP90 BETA antibody|hsp90ab1 antibody| HSP90B antibody|HSPC2 antibody|HSPCB antibody
-
Uniprot ID
P08238
-
Entrez GeneID
3326
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
