Hex Antibody

  • Catalog number
    PB9631
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Hex
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence in the middle region of human Hex(146-180aa NDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQ), different from the related mouse sequence by one amino acid.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Hex Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Hex Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Hematopoietically-expressed homeobox protein HHEX is a protein that in humans is encoded by the HHEX gene. Homeobox genes are members of a family of transcription factors that regulate tissue development in many different organisms. Hromas et al. (1993) set out to identify homeobox genes that might play a role in hematopoiesis. And using somatic cell hybrid analysis, they mapped the HHEX gene to chromosome 10, where the HOX11 gene is located. Homeobox genes are involved in neoplastic transformation of both epithelial and hemopoietic tissues. The divergent homeobox gene HEX is expressed in the anterior visceral endoderm during early mouse development and in some adult tissues of endodermal origin, including liver and thyroid. D'Elia et al.’s findings suggested that regulation of HEX entry in the nucleus of thyrocytes may represent a critical step during human thyroid tumorigenesis.
  • Related articles
    1. D'Elia, A. V., Tell, G., Russo, D., Arturi, F., Puglisi, F., Manfioletti, G., Gattei, V., Mack, D. L., Cataldi, P., Filetti, S., Di Loreto, C., Damante, G. Expression and localization of the homeodomain-containing protein HEX in human thyroid tumors. J. Clin. Endocr. Metab. 87: 1376-1383, 2002. 2. Hromas, R., Radich, J., Collins, S. PCR cloning of an orphan homeobox gene (PRH) preferentially expressed in myeloid and liver cells. Biochem. Biophys. Res. Commun. 195: 976-983, 1993.
  • Gene Name
    HHEX
  • Protein Name
    Hematopoietically-expressed homeobox protein Hhex
  • Gene Full Name
    hematopoietically expressed homeobox
  • Synonyms
    Hematopoietically expressed homeobox antibody|Hematopoietically-expressed homeobox protein HHEX antibody|HEX antibody|HHEX antibody| HHEX_HUMAN antibody|HMPH antibody|Homeobox hematopoietically expressed antibody|Homeobox protein HEX antibody|Homeobox protein PRH antibody|HOX11L PEN antibody|PRH antibody|PRHX antibody|Proline rich homeodomain containing transcription factor antibody| OTTHUMP00000206478 antibody|OTTHUMP00000206479 antibody|OTTHUMP00000206480 antibody|OTTHUMP00000206482 antibody|OTTHUMP00000207360 antibody|USURPIN antibody|Usurpin beta antibody
  • Uniprot ID
    Q03014
  • Entrez GeneID
    3087
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Hex  
  • Gene symbol
    HHEX
  • Short name
    Hex Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Hex (antibody to-)
  • Alternative technique
    antibodies
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee