-
Target antigen
Grp75
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Grp75 (646-679aa KLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ), identical to the related mouse and rat sequences.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Grp75 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Grp75 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
HSPA9 (heat shock 70kDa protein 9 (mortalin)), also known as GRP75, mot-2, mthsp75, PBP74, HSPA9B, MORTALIN or MORTALIN, PERINUCLEAR, is a highly conserved member of the HSP70 family of proteins. It functions as a chaperone in the mitochondria, cytoplasm, and centrosome. The HSPA9 gene is mapped to chromosome 5q31.2 based on an alignment of the HSPA9 sequence with the genomic sequence. Knockdown of HSPA9 in erythroid cultures was associated with an increased number of cells in the G0/G1 phase of the cell cycle and accelerated apoptosis. Knockdown of Hspa9 in mouse bone marrow cells, followed by transplantation into wildtype recipients, also resulted in loss of erythroid cell number. Haploinsufficiency for HSPA9 may contribute to abnormal hematopoiesis in myelodysplastic syndromes. This protein plays a role in the control of cell proliferation.
-
Related articles
1. Chen, T. H.-P., Kambal, A., Krysiak, K., Walshauser, M. A., Raju, G., Tibbitts, J. F., Walter, M. J. Knockdown of Hspa9, a del(5q31.2) gene, results in a decrease in hematopoietic progenitors in mice. Blood 117: 1530-1539, 2011. 2. Gross, M. B. Personal Communication. Baltimore, Md. 9/12/2011. 3. Kaul, S. C., Wadhwa, R., Matsuda, Y., Hensler, P. J., Pereira-Smith, O. M., Komatsu, Y., Mitsui, Y. Mouse and human chromosomal assignments of mortalin, a novel member of the murine hsp70 family of proteins. FEBS Lett. 361: 269-272, 1995.
-
Gene Name
HSPA9
-
Protein Name
Stress-70 protein, mitochondrial
-
Gene Full Name
heat shock 70kDa protein 9 (mortalin)
-
Synonyms
75 kDa glucose regulated protein antibody|75 kDa glucose-regulated protein antibody|CSA antibody|Glucose Regulated Protein antibody| Grp 75 antibody|GRP-75 antibody|GRP75 antibody| GRP75_HUMAN antibody|Heat shock 70 kDa protein 9 antibody|Heat shock 70kD protein 9 antibody|heat shock 70kDa protein 9 antibody|Heat shock 70kDa protein 9B antibody|Heat shock protein 74 kDa A antibody|Heat shock protein A antibody|Heat shock protein cognate 74 antibody|Hsc74 antibody|Hsp74 antibody|Hsp74a antibody|HSPA9 antibody|Hspa9a antibody|HSPA9B antibody|MGC4500 antibody|mitochondrial antibody|Mortalin 2 antibody|Mortalin antibody|Mortalin perinuclear antibody| Mortalin2 antibody|MOT 2 antibody|MOT antibody|MOT2 antibody|Mthsp70 antibody|p66 mortalin antibody|P66 MOT antibody|PBP74 antibody| Peptide binding protein 74 antibody|Peptide-binding protein 74 antibody|Stress 70 protein mitochondrial antibody|Stress 70 protein mitochondrial precursor antibody|Stress-70 protein antibody
-
Uniprot ID
P38646
-
Entrez GeneID
3313
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps