-
Target antigen
FMO2
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FMO2 (78-115aa FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK), different from the related mouse and rat sequences by two amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the FMO2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The FMO2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene. This gene encodes a flavin-containing monooxygenase family member. It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants.
-
Related articles
1. "Entrez Gene: FMO2 flavin containing monooxygenase 2 (non-functional)". 2. Dolphin CT, Shephard EA, Povey S, Smith RL, Phillips IR (Nov 1992). "Cloning, primary sequence and chromosomal localization of human FMO2, a new member of the flavin-containing mono-oxygenase family".Biochem J. 287. ( Pt 1): 261–7. 3. Dolphin CT, Beckett DJ, Janmohamed A, Cullingford TE, Smith RL, Shephard EA, Phillips IR (Dec 1998). "The flavin-containing monooxygenase 2 gene (FMO2) of humans, but not of other primates, encodes a truncated, nonfunctional protein". J Biol Chem 273 (46): 30599–607.
-
Gene Name
FMO2
-
Protein Name
Dimethylaniline monooxygenase [N-oxide-forming] 2
-
Gene Full Name
flavin containing monooxygenase 2
-
Synonyms
2310008D08Rik antibody|2310042I22Rik antibody|AW107733 antibody|Dimethylaniline monooxygenase [N oxide forming] 2 antibody| Dimethylaniline monooxygenase [N-oxide-forming] 2 antibody|Dimethylaniline oxidase 2 antibody|Flavin containing monooxygenase 2 (non functional) antibody|Flavin containing monooxygenase 2 antibody|FLJ40826 antibody|FMO 1B1 antibody|FMO 2 antibody|FMO antibody|FMO pulmonary antibody|FMO1B1 antibody|FMO2 antibody|FMO2_HUMAN antibody|MGC28212 antibody|OTTMUSP00000028686 antibody|OTTMUSP00000028687 antibody|Pulmonary flavin containing monooxygenase 2 antibody|Pulmonary flavin-containing monooxygenase 2 antibody
-
Uniprot ID
Q99518
-
Entrez GeneID
2327
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
