FDCSP Antibody

• Catalog number
  A13093-1
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  FDCSP
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the FDCSP Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The FDCSP Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  FDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
• Related articles
  1. Aaron J. Marshall; et al. (September 1, 2002). "FDC-SP, a Novel Secreted Protein Expressed by Follicular Dendritic Cells". The Journal of Immunology. 169 (5): 2381–2389. 2. Tamayuki Shinomura; et al. (November 28, 2008). "Adsorption of Follicular Dendritic Cell-secreted Protein (FDC-SP) onto Mineral Deposits". J. Biol. Chem. 283 (48): 33658–33664.
• Gene Name
  FDCSP
• Protein Name
  Follicular dendritic cell secreted peptide
• Gene Full Name
  follicular dendritic cell secreted protein
• Synonyms
  C4orf7 | FDC-SP | FDCSP | Q8NFU4
• Uniprot ID
  Q8NFU4
• Entrez GeneID
  260436
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  FDCSP  
• Gene symbol
  FDCSP
• Short name
  FDCSP Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  FDCSP (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:19215
• Gene
  FDCSP
• Long gene name
  follicular dendritic cell secreted protein
• Synonyms gene
  • C4orf7
• Synonyms gene name
  • chromosome 4 open reading frame 7
• Synonyms
  • FDC-SP
• GenBank acession
  • AF435080
• Locus
  4q13.3
• Discovery year
  2002-09-17
• Entrez gene record
  260436
• Pubmed identfication
  • 12193705
  • 17548624
  • 20811673
• RefSeq identity
  • NM_152997
• VEGA ID
  OTTHUMG00000129393

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products