FDCSP Antibody
-
Catalog numberA13093-1
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenFDCSP
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesIHC-P
-
ImmunogenA synthetic peptide corresponding to a sequence in the middle region of human FDCSP (18-51aa FPVSQDQEREKRSISDSDELASGFFVFPYPYPFR).
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the FDCSP Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe FDCSP Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundFDC-SP or follicular dendritic cell-secreted protein, is a small, secreted protein, located on chromosome 4 in humans. FDC-SP is a 68-amino acid protein containing a signal peptide at its N terminus, which is used for directing the transport of the protein. This protein specifically binds to activated B cells, and functions as a regulator of antibody responses. It is also thought to contribute to tumor metastases by promoting cancer cell migration and invasion.
-
Related articles1. Aaron J. Marshall; et al. (September 1, 2002). "FDC-SP, a Novel Secreted Protein Expressed by Follicular Dendritic Cells". The Journal of Immunology. 169 (5): 2381–2389. 2. Tamayuki Shinomura; et al. (November 28, 2008). "Adsorption of Follicular Dendritic Cell-secreted Protein (FDC-SP) onto Mineral Deposits". J. Biol. Chem. 283 (48): 33658–33664.
-
Gene NameFDCSP
-
Protein NameFollicular dendritic cell secreted peptide
-
Gene Full Namefollicular dendritic cell secreted protein
-
SynonymsC4orf7 | FDC-SP | FDCSP | Q8NFU4
-
Uniprot IDQ8NFU4
-
Entrez GeneID260436
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolFDCSP
-
Short nameFDCSP Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameFDCSP (antibody to-)
-
Alternative techniqueantibodies
-
Gene info
-
Identity
-
Gene
-
Long gene namefollicular dendritic cell secreted protein
-
Synonyms gene
-
Synonyms gene name
- chromosome 4 open reading frame 7
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2002-09-17
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
VEGA ID
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data