Fascin Antibody

• Catalog number
  PB9592
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  Fascin
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human Fascin (42-73aa KKQIWTLEQPPDEAGSAAVCLRSHLGRYLAAD), identical to the related mouse sequence, and different from the related rat sequence by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the Fascin Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The Fascin Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Fascin is an actin cross-linking protein. The Fascin gene contains 5 exons and spans 7 kb. It is a 54-58 kilodalton monomeric actin filament bundling protein originally isolated from sea urchin egg but also found in Drosophila and vertebrates, including humans. Fascin (from the Latin for bundle) is spaced at 11 nanometre intervals along the filament. The bundles in cross section are seen to be hexagonally packed, and the longitudinal spacing is compatible with a model where fascin cross-links at alternating 4 and 5 actins. It is calcium insensitive and monomeric. Fascin binds beta-catenin, and colocalizes with it at the leading edges and borders of epithelial and endothelial cells. The role of Fascin in regulating cytoskeletal structures for the maintenance of cell adhesion, coordinating motility and invasion through interactions with signalling pathways is an active area of research especially from the cancer biology perspective. Abnormal fascin expression or function has been implicated in breast cancer, colon cancer, esophageal squamous cell carcinoma, gallbladder cancer and prostate cancer.
• Related articles
  1. Saishin, Y., Shimada, S., Morimura, H., Sato, K., Ishimoto, I., Tano, Y., Tohyama, M.Isolation of a cDNA encoding a photoreceptor cell-specific actin-bundling protein: retinal fascin.FEBS Lett. 414: 381-386, 1997. 2. Wada, Y., Abe, T., Takeshita, T., Sato, H., Yanashima, K., Tamai, M.Mutation of human retinal fascin gene (FSCN2) causes autosomal dominant retinitis pigmentosa.Invest. Ophthal. Vis. Sci. 42: 2395-2400, 2001.
• Gene Name
  FSCN1
• Protein Name
  Fascin
• Gene Full Name
  fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
• Synonyms
  55 kDa actin bundling protein antibody|55 kDa actin-bundling protein antibody|Actin bundling protein antibody|actin bundling protein, 55-KD antibody|FAN 1 antibody|FAN1 antibody|Fascin 1 antibody|Fascin antibody|Fascin homolog 1 actin bundling protein (Strongylocentrotus purpuratus) antibody|Fascin homolog 1 antibody|Fascin, sea urchin, homolog of, 1 antibody|Fascin1 antibody| FLJ38511 antibody|FSCN 1 antibody|FSCN1 antibody|FSCN1_HUMAN antibody|HSN antibody|p55 antibody|Singed (Drosophila) like (sea urchin fascin homolog like) antibody|Singed drosophila homolog like antibody|Singed like (fascin homolog sea urchin) (Drosophila) antibody| Singed like (fascin homolog sea urchin) antibody|Singed like protein antibody|Singed, drosophila, homolog of antibody|Singed-like protein antibody|SNL antibody|Strongylocentrotus purpuratus antibody
• Uniprot ID
  Q16658
• Entrez GeneID
  6624
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  Fascin  
• Gene symbol
  FSCN3, FSCN2, FSCN1
• Short name
  Fascin Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  Fascin (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:3961
• Gene
  FSCN3
• Long gene name
  fascin actin-bundling protein 3
• Synonyms gene name
  • fascin (Strongylocentrotus purpuratus) homolog 3 (actin-bundling protein, testicular)
  • fascin homolog 3, actin-bundling protein, testicular (Strongylocentrotus purpuratus)
  • fascin actin-bundling protein 3, testicular
• Locus
  7q32.1
• Discovery year
  2000-02-29
• Entrez gene record
  29999
• Pubmed identfication
  • 11925108
• RefSeq identity
  • NM_020369
• Classification
  • Fascin family
• VEGA ID
  OTTHUMG00000022935

Gene info

• Identity
  HGNC:3960
• Gene
  FSCN2
• Long gene name
  fascin actin-bundling protein 2, retinal
• Synonyms gene name
  • fascin (Strongylocentrotus purpuratus) homolog 2 (actin-bundling protein, retinal)
  • fascin homolog 2, actin-bundling protein, retinal (Strongylocentrotus purpuratus)
• Synonyms
  • RP30
  • RFSN
• Synonyms name
  • retinal fascin
• GenBank acession
  • AF030165
• Locus
  17q25.3
• Discovery year
  2000-02-29
• Entrez gene record
  25794
• Pubmed identfication
  • 10234509
• RefSeq identity
  • NM_012418
• Classification
  • Fascin family
• VEGA ID
  OTTHUMG00000167477
• Locus Specific Databases
  • Mutations of the Fascin Gene

Gene info

• Identity
  HGNC:11148
• Gene
  FSCN1
• Long gene name
  fascin actin-bundling protein 1
• Synonyms gene
  • SNL
• Synonyms gene name
  • singed (Drosophila)-like (sea urchin fascin homolog like)
  • fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus)
• Synonyms
  • p55
  • FLJ38511
• Synonyms name
  • Singed, drosophila, homolog-like
  • actin bundling protein
• GenBank acession
  • U03057
• Locus
  7p22.1
• Discovery year
  1995-01-16
• Entrez gene record
  6624
• Pubmed identfication
  • 8068206
  • 10783262
• RefSeq identity
  • NM_003088
• Classification
  • Fascin family
• VEGA ID
  OTTHUMG00000090599

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products