-
Target antigen
ERp57
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
mouse
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ERp57 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ERp57 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
-
Related articles
1. "Entrez Gene: PDIA3 protein disulfide isomerase family A, member 3". 2. Ellerman, D. A., Myles, D. G., Primakoff, P. A role for sperm surface protein disulfide isomerase activity in gamete fusion: evidence for the participation of ERp57. Dev. Cell 10: 831-837, 2006 3. Garbi, N., Tanaka, S., Momburg, F., Hammerling, G. J. Impaired assembly of the major histocompatibility complex class I peptide-loading complex in mice deficient in the oxidoreductase ERp57. Nature Immun. 7: 93-102, 2006.
-
Gene Name
PDIA3
-
Protein Name
Protein disulfide-isomerase A3
-
Gene Full Name
protein disulfide isomerase family A, member 3
-
Synonyms
58 kDa glucose regulated protein antibody|58 kDa glucose-regulated protein antibody|58 kDa microsomal protein antibody|Disulfide isomerase ER 60 antibody|Disulfide isomerase ER-60 antibody|Endoplasmic reticulum resident protein 57 antibody|Endoplasmic reticulum resident protein 60 antibody|ER p57 antibody|ER protein 57 antibody|ER protein 60 antibody|ERp 57 antibody|ERp57 antibody|ERp60 antibody|ERp61 antibody|Glucose Regulated Protein 58 Kd antibody|GRP 57 antibody|GRP 58 antibody|GRP57 antibody|GRP58 antibody| HsT17083 antibody|P58 antibody|PDIA 3 antibody|PDIA3 antibody|PDIA3_HUMAN antibody|Phospholipase C alpha antibody|PI PLC antibody| Protein disulfide isomerase A3 antibody|Protein disulfide isomerase family A member 3 antibody|Protein disulfide-isomerase A3 antibody
-
Uniprot ID
P30101
-
Entrez GeneID
2923
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps