ERp57 Antibody

  • Catalog number
    PB9772
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    ERp57
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    mouse
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human ERp57 (471-505aa RELSDFISYLQREATNPPVIQEEKPKKKKKAQEDL), different from the related mouse and rat sequences by two amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the ERp57 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The ERp57 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    PDIA3 (Protein disulfide isomerase family A, member 3), also called GRP58, Erp57 or ER60, is an isomerase enzyme. It is mapped on 15q15.3. PDIA3 is also part of the major histocompatibility complex (MHC) class I peptide-loading complex, which is essential for formation of the final antigen conformation and export from the endoplasmic reticulum to the cell surface. This gene encodes a protein of the endoplasmic reticulum that interacts with lectin chaperones calreticulin and calnexin to modulate folding of newly synthesized glycoproteins. The protein was once thought to be a phospholipase; however, it has been demonstrated that the protein actually has protein disulfide isomerase activity. It is thought that complexes of lectins and this protein mediate protein folding by promoting formation of disulfide bonds in their glycoprotein substrates.
  • Related articles
    1. "Entrez Gene: PDIA3 protein disulfide isomerase family A, member 3". 2. Ellerman, D. A., Myles, D. G., Primakoff, P. A role for sperm surface protein disulfide isomerase activity in gamete fusion: evidence for the participation of ERp57. Dev. Cell 10: 831-837, 2006 3. Garbi, N., Tanaka, S., Momburg, F., Hammerling, G. J. Impaired assembly of the major histocompatibility complex class I peptide-loading complex in mice deficient in the oxidoreductase ERp57. Nature Immun. 7: 93-102, 2006.
  • Gene Name
    PDIA3
  • Protein Name
    Protein disulfide-isomerase A3
  • Gene Full Name
    protein disulfide isomerase family A, member 3
  • Synonyms
    58 kDa glucose regulated protein antibody|58 kDa glucose-regulated protein antibody|58 kDa microsomal protein antibody|Disulfide isomerase ER 60 antibody|Disulfide isomerase ER-60 antibody|Endoplasmic reticulum resident protein 57 antibody|Endoplasmic reticulum resident protein 60 antibody|ER p57 antibody|ER protein 57 antibody|ER protein 60 antibody|ERp 57 antibody|ERp57 antibody|ERp60 antibody|ERp61 antibody|Glucose Regulated Protein 58 Kd antibody|GRP 57 antibody|GRP 58 antibody|GRP57 antibody|GRP58 antibody| HsT17083 antibody|P58 antibody|PDIA 3 antibody|PDIA3 antibody|PDIA3_HUMAN antibody|Phospholipase C alpha antibody|PI PLC antibody| Protein disulfide isomerase A3 antibody|Protein disulfide isomerase family A member 3 antibody|Protein disulfide-isomerase A3 antibody
  • Uniprot ID
    P30101
  • Entrez GeneID
    2923
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    ERp57  
  • Gene symbol
    PDIA3
  • Short name
    ERp57 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    ERp57 (antibody to-)
  • Alternative technique
    antibodies
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee