DGAT1 Antibody

• Catalog number
  PB9801
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  DGAT1
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the DGAT1 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The DGAT1 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.
• Related articles
  1. Cases, S., Smith, S. J., Zheng, Y.-W., Myers, H. M., Lear, S. R., Sande, E., Novak, S., Collins, C., Welch, C. B., Lusis, A. J., Erickson, S. K., Farese, R. V., Jr. Identification of a gene encoding an acyl CoA:diacylglycerol acyltransferase, a key enzyme in triacylglycerol synthesis. Proc. Nat. Acad. Sci. 95: 13018-13023, 1998. 2. Cheng D, Iqbal J, Devenny J, Chu CH, Chen L, Dong J, Seethala R, Keim WJ, Azzara AV, Lawrence RM, Pelleymounter MA, Hussain MM (October 2008)."Acylation of acylglycerols by acyl coenzyme A:diacylglycerol acyltransferase 1 (DGAT1). Functional importance of DGAT1 in the intestinal fat absorption". J. Biol. Chem. 283 (44): 29802–11. 3. Herker, E., Harris, C., Hernandez, C., Carpentier, A., Kaehlcke, K., Rosenberg, A. R., Farese, R. V., Jr., Ott, M. Efficient hepatitis C virus particle formation requires diacylglycerol acyltransferase-1. Nature Med. 16: 1295-1298, 2010.
• Gene Name
  DGAT1
• Protein Name
  Diacylglycerol O-acyltransferase 1
• Gene Full Name
  diacylglycerol O-acyltransferase 1
• Synonyms
  ACAT related gene product 1 antibody|ACAT-related gene product 1 antibody|Acyl coenzyme A:cholesterol acyltransferase related gene 1 antibody|Acyl-CoA retinol O-fatty-acyltransferase antibody|Acyl-CoA:diacylglycerol acyltransferase antibody|ARAT antibody| ARGP1 antibody|C75990 antibody|D15Ertd23e antibody|Dgat antibody|DGAT1 antibody|DGAT1_HUMAN antibody|Diacylglycerol O acyltransferase 1 antibody|Diacylglycerol O-acyltransferase 1 antibody|DIAR7 antibody|Diglyceride acyltransferase antibody|EC 2.3.1.20 antibody| hCG_24006 antibody|MGC139064 antibody|Retinol O fatty acyltransferase antibody
• Uniprot ID
  O75907
• Entrez GeneID
  8694
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  DGAT1  
• Gene symbol
  DGAT1
• Short name
  DGAT1 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  DGAT1 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:2843
• Gene
  DGAT1
• Long gene name
  diacylglycerol O-acyltransferase 1
• Synonyms gene
  • DGAT
• Synonyms gene name
  • diacylglycerol O-acyltransferase (mouse) homolog
• Synonyms
  • ARGP1
• GenBank acession
  • AF059202
• Locus
  8q24.3
• Discovery year
  1998-11-11
• Entrez gene record
  8694
• Pubmed identfication
  • 9756920
• RefSeq identity
  • NM_012079
• Classification
  • MicroRNA protein coding host genes
• VEGA ID
  OTTHUMG00000174606

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products