-
Target antigen
cRel
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD), different from the related human sequence by four amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the cRel Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The cRel Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-κB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.
-
Related articles
1. Belguise, K., Sonenshein, G. E. PKC-theta promotes c-Rel-driven mammary tumorigenesis in mice and humans by repressing estrogen receptor-alpha synthesis. J. Clin. Invest. 117: 4009-4021, 2007. 2. Gilmore TD, Kalaitzidis D, Liang MC, Starczynowski DT (March 2004). "The c-Rel transcription factor and B-cell proliferation: a deal with the devil". Oncogene 23 (13): 2275–86. 3. Ruben SM, Klement JF, Coleman TA, Maher M, Chen CH, Rosen CA (Jun 1992). "I-Rel: a novel rel-related protein that inhibits NF-kappa B transcriptional activity". Genes Dev 6 (5): 745–60.
-
Gene Name
REL
-
Protein Name
Proto-oncogene c-Rel
-
Gene Full Name
v-rel avian reticuloendotheliosis viral oncogene homolog
-
Synonyms
Avian reticuloendotheliosis antibody|C REL antibody|C Rel protein antibody|c Rel proto oncogene protein antibody|Oncogene REL antibody|Oncogene REL avian reticuloendotheliosis antibody|Proto-oncogene c-Rel antibody|REL antibody|REL_HUMAN antibody|v rel avian reticuloendotheliosis viral oncogene homolog antibody|v rel reticuloendotheliosis viral oncogene homolog antibody|V rel reticuloendotheliosis viral oncogene homolog (avian) antibody
-
Uniprot ID
P15307
-
Entrez GeneID
19696
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
