Connexin 45/GJA7 Antibody

  • Catalog number
    A08562
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Connexin 45/GJA7
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB,IHC-P
  • Immunogen
    A synthetic peptide corresponding to a sequence at the N-terminus of human Connexin 45/GJA7 (91-131aa YLGYAIHKIAKMEHGEADKKAARSKPYAMRWKQHRALEETE), identical to the related mouse and rat sequences.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Connexin 45/GJA7 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Connexin 45/GJA7 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
  • Related articles
    1. Kaba, R. A., Coppen, S. R., Dupont, E., Skepper, J. N., Elneil, S., Haw, M. P., Pepper, J. R., Yacoub, M. H., Rothery, S., Severs, N. J. Comparison of connexin 43, 40 and 45 expression patterns in the developing human and mouse hearts. Cell Commun. Adhesion 8: 339-343, 2001. 2. Tsai, M.-Y., Lan, K.-C., Huang, K.-E., Huang, F.-J., Kung, F.-T., Chang, S.-Y. Significance of mRNA levels of connexin37, connexin43, and connexin45 in luteinized granulosa cells of controlled hyperstimulated follicles. Fertil. Steril. 80: 1437-1443, 2003.
  • Gene Name
    GJC1
  • Protein Name
    Gap junction gamma-1 protein
  • Gene Full Name
    gap junction protein, gamma 1
  • Synonyms
    Gap junction gamma-1 protein | Connexin-45 | Cx45 | Gap junction alpha-7 protein | GJC1 | GJA7 | P36383
  • Uniprot ID
    P36383
  • Entrez GeneID
    10052
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
  • Gene symbol
    GJC1
  • Short name
    Connexin 45/GJA7 Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    Connexin 45/GJA7 (antibody to-)
  • Alternative technique
    antibodies
Gene info
  • Identity
  • Gene
  • Long gene name
    gap junction protein gamma 1
  • Synonyms gene
  • Synonyms gene name
    • gap junction protein, alpha 7, 45kDa
    • gap junction protein, gamma 1, 45kDa
  • Synonyms
  • Synonyms name
  • GenBank acession
  • Locus
  • Discovery year
    1999-07-30
  • Entrez gene record
  • Pubmed identfication
  • RefSeq identity
  • Classification
    • Gap junction proteins
  • VEGA ID
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee