-
Target antigen
Connexin 45/GJA7
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, rat
-
Analyses
WB
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Connexin 45/GJA7 (333-363aa ADLEALQREIRMAQERLDLAVQAYSHQNNP H), different from the related mouse and rat sequences by three amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Connexin 45/GJA7 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Connexin 45/GJA7 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Gap junction gamma-1 protein (GJC1), also known as gap junction alpha-7 protein (GJA7) or connexin 45 (Cx45), is a protein that in humans is encoded by the GJC1 gene. The International Radiation Hybrid Mapping Consortium mapped the GJA7 gene to chromosome 17q21.31. This gene is a member of the connexin gene family. The encoded protein is a component of gap junctions, which are composed of arrays of intercellular channels that provide a route for the diffusion of low molecular weight materials from cell to cell.
-
Related articles
1. Kaba, R. A., Coppen, S. R., Dupont, E., Skepper, J. N., Elneil, S., Haw, M. P., Pepper, J. R., Yacoub, M. H., Rothery, S., Severs, N. J. Comparison of connexin 43, 40 and 45 expression patterns in the developing human and mouse hearts. Cell Commun. Adhesion 8: 339-343, 2001. 2. Tsai, M.-Y., Lan, K.-C., Huang, K.-E., Huang, F.-J., Kung, F.-T., Chang, S.-Y. Significance of mRNA levels of connexin37, connexin43, and connexin45 in luteinized granulosa cells of controlled hyperstimulated follicles. Fertil. Steril. 80: 1437-1443, 2003.
-
Gene Name
GJC1
-
Protein Name
Gap junction gamma-1 protein
-
Gene Full Name
gap junction protein, gamma 1, 45kDa
-
Synonyms
Connexin 45 antibody|Connexin-45 antibody|Connexin45 antibody|CX 31.9 antibody|CX 45 antibody|CX31.9 antibody|Cx45 antibody|CXG1_HUMAN antibody|DKFZp686P0738 antibody|Gap junction alpha 7 protein antibody|Gap junction alpha-7 protein antibody|Gap junction gamma 1 protein antibody|Gap junction gamma-1 protein antibody|Gap junction protein alpha 7 45kDa antibody|Gap junction protein alpha 7 antibody|Gap junction protein, gamma 1, 45kDa antibody|GJA 7 antibody|GJA7 antibody|GJC1 antibody|GJD3 antibody
-
Uniprot ID
P36383
-
Entrez GeneID
10052
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
