-
Target antigen
Calpastatin
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human, mouse, rat
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Calpastatin (275-310aa QEKKRKVEKDTMSDQALEALSASLGTRQAEPELDLR), different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by eleven amino acids.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the Calpastatin Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The Calpastatin Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
Calpastatin is a protein that in humans is encoded by the CAST gene. It is mapped to 5q15. The protein encoded by this gene is an endogenous calpain (calcium-dependent cysteine protease) inhibitor. It consists of an N-terminal domain L and four repetitive calpain-inhibition domains (domains 1-4), and it is involved in the proteolysis of amyloid precursor protein. The calpain/calpastatin system is involved in numerous membrane fusion events, such as neural vesicle exocytosis and platelet and red-cell aggregation. The encoded protein is also thought to affect the expression levels of genes encoding structural or regulatory proteins. Alternatively spliced transcript variants encoding different isoforms have been described.
-
Related articles
1. Averna M, De Tullio R, Capini P, Salamino F, Pontremoli S, Melloni E (Dec 2003). "Changes in calpastatin localization and expression during calpain activation: a new mechanism for the regulation of intracellular Ca(2+)-dependent proteolysis". Cell Mol Life Sci. 60 (12): 2669–78. 2. Ma H, Yang HQ, Takano E, Lee WJ, Hatanaka M, Maki M (Sep 1993). "Requirement of different subdomains of calpastatin for calpain inhibition and for binding to calmodulin-like domains". J Biochem. 113 (5): 591–9. 3. Raynaud P, Jayat-Vignoles C, Laforet MP, Leveziel H, Amarger V (Apr 2005). "Four promoters direct expression of the calpastatin gene". Arch Biochem Biophys. 437 (1): 69–77.
-
Gene Name
CAST
-
Protein Name
Calpastatin
-
Gene Full Name
calpastatin
-
Synonyms
BS 17 | Calpain inhibitor | Calpastatin | Cast | PLACK | Sperm BS 17 component | Sperm BS-17 component | P20810
-
Uniprot ID
P20810
-
Entrez GeneID
831
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
