BDKRB2 Antibody

• Catalog number
  PB10047
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  BDKRB2
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  mouse
• Analyses
  WB
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human BDKRB2 (357-391aa RSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ), different from the related mouse sequence by five amino acids, and from the related rat sequence by seven amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the BDKRB2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The BDKRB2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Bradykinin receptor B2 is a G-protein coupled receptor forbradykinin, encoded by the BDKRB2 gene in humans. This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.
• Related articles
  1. Fernandes L, Fortes ZB, Nigro D, Tostes RC, Santos RA, Catelli De Carvalho MH (2001). "Potentiation of bradykinin by angiotensin-(1-7) on arterioles of spontaneously hypertensive rats studied in vivo".Hypertension 37 (2 Part 2): 703–9. 2. Hess JF, Borkowski JA, Young GS, et al. (1992). "Cloning and pharmacological characterization of a human bradykinin (BK-2) receptor.". Biochem. Biophys. Res. Commun. 184 (1): 260–8.
• Gene Name
  BDKRB2
• Protein Name
  B2 bradykinin receptor
• Gene Full Name
  bradykinin receptor B2
• Synonyms
  B2 | B2BKR | B2BRA | B2R | BDKR B2 | BDKRB 2 | BDKRB2 | BK 2 | BK 2 receptor | BK R2 | BK-2 receptor | BK2 | BK2 receptor | BK2R | BKR 2 | BKR2 | BR B2 | BRB 2 | BRB2 | Kinin B2 | P30411
• Uniprot ID
  P30411
• Entrez GeneID
  624
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  BDKRB2  
• Gene symbol
  BDKRB2
• Short name
  BDKRB2 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  bradykinin receptor B2 (antibody to-)
• Alternative technique
  antibodies
• Alternative to gene target
  bradykinin receptor B2, B2R and BK-2 and BK2 and BKR2 and BRB2, BDKRB2 and IDBG-18990 and ENSG00000168398 and 624, protein heterodimerization activity, Plasma membranes, Bdkrb2 and IDBG-169186 and ENSMUSG00000021070 and 12062, BT.72991 and IDBG-634176 and ENSBTAG00000021717 and 538896

Gene info

• Identity
  HGNC:1030
• Gene
  BDKRB2
• Long gene name
  bradykinin receptor B2
• Synonyms
  • BK-2
• GenBank acession
  • S56772
• Locus
  14q32.2
• Discovery year
  1993-04-07
• Entrez gene record
  624
• Pubmed identfication
  • 7916737
• Classification
  • Bradykinin receptors
• VEGA ID
  OTTHUMG00000171408

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products