BCRP/ABCG2 Antibody

• Catalog number
  PB9364
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  BCRP/ABCG2
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human
• Analyses
  WB,IHC-P,IHC-F
• Immunogen
  A synthetic peptide corresponding to a sequence at the N-terminus of human ABCG2(137-168aa RENLQFSAALRLATTMTNHEKNERINRVIQEL), different from the related mouse sequence by five amino acids, and from the related rat sequence by eight amino acids.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the BCRP/ABCG2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The BCRP/ABCG2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  ABCG2(Atp-binding cassette, subfamily g, member 2) also known as ABCP, BCRP or MRX, is a protein that in humans is encoded by the ABCG2 gene. The ABCG2 gene encodes a membrane transporter belonging to the ATP-binding cassette (ABC) superfamily of membrane transporters, which are involved in the trafficking of biologic molecules across cell membranes. The ABCG2 protein is also a high capacity transporter for uric acid excretion in the kidney, liver, and gut. The ABCG2 gene is mapped on 4q22.1. In vitro assays of isolated membrane preparations revealed a high-capacity, vanadate-sensitive ATPase activity associated with ABCG2 expression that was stimulated by compounds known to be transported by this protein. Ozvegy et al. (2001) concluded that ABCG2 is likely functioning as a homodimer or homooligomer in this expression system since it is unlikely that putative Sf9 transport partners would be overexpressed at similarly high levels.Abcg2 transports pheophorbide-a, which occurs in various plant-derived foods and food supplements and is highly efficient in limiting its uptake from ingested food. ABCG2 is a major factor in the concentrative transfer of drugs, carcinogens, and dietary toxins to the milk of mice, cows, and humans.
• Related articles
  1. Jonker, J. W., Merino, G., Musters, S., van Herwaarden, A. E., Bolscher, E., Wagenaar, E., Mesman, E., Dale, T. C., Schinkel, A. H. The breast cancer resistance protein BCRP (ABCG2) concentrates drugs and carcinogenic xenotoxins into milk. Nature Med. 11: 127-129, 2005. 2. Matsuo, H., Takada, T., Ichida, K., Nakamura, T., Nakayama, A., Ikebuchi, Y., Ito, K., Kusanagi, Y., Chiba, T., Tadokoro, S., Takada, Y., Oikawa, Y., and 22 others. Common defects of ABCG2, a high-capacity urate exporter, cause gout: a function-based genetic analysis in a Japanese population.Sci. Transl. Med. 1: 5ra11, 2009. 3. Ozvegy, C., Litman, T., Szakacs, G., Nagy, Z., Bates, S., Varadi, A., Sarkadi, B. Functional characterization of the human multidrug transporter, ABCG2, expressed in insect cells.Biochem. Biophys. Res. Commun. 285: 111-117, 2001.
• Gene Name
  ABCG2
• Protein Name
  ATP-binding cassette sub-family G member 2
• Gene Full Name
  ATP-binding cassette, sub-family G (WHITE), member 2
• Synonyms
  ABC transporter antibody|ABC15 antibody|ABCG 2 antibody|ABCG2 antibody|ABCG2_HUMAN antibody|ABCP antibody|ATP binding cassette sub family G (WHITE) member 2 antibody|ATP binding cassette transporter G2 antibody|ATP-binding cassette sub-family G member 2 antibody|BCRP antibody|BCRP1 antibody|BMDP antibody|Breast cancer resistance protein antibody|CD338 antibody|CDw338 antibody|CDw338 antigen antibody|EST157481 antibody|GOUT1 antibody|MGC102821 antibody|Mitoxantrone resistance associated protein antibody|Mitoxantrone resistance-associated protein antibody|MRX antibody|Multi drug resistance efflux transport ATP binding cassette sub family G (WHITE) member 2 antibody|MXR antibody|MXR1 antibody|Placenta specific ATP binding cassette transporter antibody|Placenta specific MDR protein antibody|Placenta-specific ATP-binding cassette transporter antibody|UAQTL1 antibody
• Uniprot ID
  Q9UNQ0
• Entrez GeneID
  9429
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  BCRP/ABCG2  
• Gene symbol
  ABCG2
• Short name
  BCRP/ABCG2 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  BCRP/ABCG2 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:74
• Gene
  ABCG2
• Long gene name
  ATP binding cassette subfamily G member 2 (Junior blood group)
• Synonyms gene name
  • ATP-binding cassette, sub-family G (WHITE), member 2
  • ATP-binding cassette, sub-family G (WHITE), member 2 (Junior blood group)
• Synonyms
  • EST157481
  • MXR
  • BCRP
  • ABCP
  • CD338
• GenBank acession
  • AF103796
• Locus
  4q22.1
• Discovery year
  1999-10-26
• Entrez gene record
  9429
• Pubmed identfication
  • 8894702
  • 9861027
• RefSeq identity
  • NM_004827
• Classification
  • ATP binding cassette subfamily G
  • Blood group antigens
  • CD molecules
• VEGA ID
  OTTHUMG00000130601
• Locus Specific Databases
  • LRG_823

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products