ATX2 Antibody

• Catalog number
  PB9483
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  ATX2
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human ATX2 (1283-1313aa QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL), identical to the related mouse sequence.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the ATX2 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The ATX2 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  Ataxin-2, the protein encoded by the ATXN2 gene, contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells.
• Related articles
  1. Pulst, S.-M., Nechiporuk, A., Nechiporuk, T., Gispert, S., Chen, X.-N., Lopes-Cendes, I., Pearlman, S., Starkman, S., Orozco-Diaz, G., Lunkes, A., DeJong, P., Rouleau, G. A., Auburger, G., Korenberg, J. R., Figueroa, C., Sahba, S. Moderate expansion of a normally biallelic trinucleotide repeat in spinocerebellar ataxia type 2. 2. Ralser, M., Nonhoff, U., Albrecht, M., Lengauer, T., Wanker, E. E., Lehrach, H., Krobitsch, S. Ataxin-2 and huntingtin interact with endophilin-A complexes to function in plastin-associated pathways. Hum. Molec. Genet. 14: 2893-2909, 2005.
• Gene Name
  ATXN2
• Protein Name
  Ataxin-2
• Gene Full Name
  ataxin 2
• Synonyms
  Ataxin 2 antibody|ATXN2 antibody|Olivopontocerebellar ataxia 2, autosomal dominant antibody|SCA2 antibody|Spinocerebellar ataxia type 2 protein antibody|TNRC13 antibody| Trinucleotide repeat containing gene 13 protein antibody
• Uniprot ID
  Q99700
• Entrez GeneID
   6311
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATX2  
• Gene symbol
  ATXN2
• Short name
  ATX2 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  ATX2 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:10555
• Gene
  ATXN2
• Long gene name
  ataxin 2
• Synonyms gene
  • SCA2
  • TNRC13
• Synonyms gene name
  • spinocerebellar ataxia 2 (olivopontocerebellar ataxia 2, autosomal dominant, ataxin 2)
• Synonyms
  • ATX2
• Synonyms name
  • trinucleotide repeat containing 13
• GenBank acession
  • U80749
• Locus
  12q24.12
• Discovery year
  1991-08-06
• Entrez gene record
  6311
• Pubmed identfication
  • 8358438
  • 9225980
• RefSeq identity
  • NM_002973
• Classification
  • Ataxins
• VEGA ID
  OTTHUMG00000133475
• Locus Specific Databases
  • LRG_864

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products