ATF6 Antibody

• Catalog number
  A00655
• Price
  Please ask
• Size
  0,1 mg

• Target antigen
  ATF6
• Clonality
  Polyclonal antibody
• Clone
  Polyclonal antibody
• Raised in
  rabbit
• Type of the antibody
  IgG polyclonal antibody
• Product form
  freeze-dried
• Reacts with species
  human, mouse, rat
• Analyses
  WB,IHC-P
• Immunogen
  A synthetic peptide corresponding to a sequence at the C-terminus of human ATF6 (597-629aa AININENVINGQDYEVMMQIDCQVMDTRILHIK), different from the related mouse and rat sequences by one amino acid.
• Product configuration
  Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Purification
  Immunogen affinity purified.
• Solubilization
  The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
• Storage condtions
  Keep the ATF6 Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
• Tips
  The ATF6 Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
• Background
  ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).
• Related articles
  1. Li, M.; Baumeister, P.; Roy, B.; Phan, T.; Foti, D.; Luo, S.; Lee, A. S. : ATF6 as a transcription activator of the endoplasmic reticulum stress element: thapsigargin stress-induced changes and synergistic interactions with NF-Y and YY1. Molec. Cell. Biol. 20: 5096-5106, 2000. 2. Thameem, F.; Farook, V. S.; Bogardus, C.; Prochazka, M. : Association of amino acid variants in the activating transcription factor 6 gene (ATF6) on 1q21-q23 with type 2 diabetes in Pima Indians. Diabetes 55: 839-842, 2006.
• Gene Name
  ATF6
• Protein Name
  Cyclic AMP-dependent transcription factor ATF-6 alpha
• Gene Full Name
  activating transcription factor 6
• Synonyms
  Cyclic AMP-dependent transcription factor ATF-6 alpha | cAMP-dependent transcription factor ATF-6 alpha | Activating transcription factor 6 alpha | ATF6-alpha | Processed cyclic AMP-dependent transcription factor ATF-6 alpha | ATF6 | P18850
• Uniprot ID
  P18850
• Entrez GeneID
  22926
• Properties
  If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
• French translation
  anticorps

• Gene target
  ATF6  
• Gene symbol
  ATF6, ATF6-DT
• Short name
  ATF6 Antibody
• Technique
  Antibody, antibodies against human proteins, antibodies for
• Alternative name
  ATF6 (antibody to-)
• Alternative technique
  antibodies

Gene info

• Identity
  HGNC:791
• Gene
  ATF6
• Long gene name
  activating transcription factor 6
• Synonyms
  • ATF6A
• Synonyms name
  • activating transcription factor 6 alpha
• GenBank acession
  • AB015856
• Locus
  1q23.3
• Discovery year
  1999-12-15
• Entrez gene record
  22926
• Pubmed identfication
  • 9837962
  • 9271374
  • 11256944
• RefSeq identity
  • NM_007348
• Classification
  • Basic leucine zipper proteins
• VEGA ID
  OTTHUMG00000023961

Gene info

• Identity
  HGNC:55826
• Gene
  ATF6-DT
• Long gene name
  ATF6 divergent transcript
• Locus
  1q23.3
• Discovery year
  2021-08-02
• Entrez gene record
  102724329
• Classification
  • Divergent transcripts

MeSH Data

• Name
  Blotting, Western
• Concept
  Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
• Tree numbers
  • E05.196.401.143
  • E05.301.300.096
  • E05.478.566.320.200
  • E05.601.262
  • E05.601.470.320.200
• Qualifiers
  ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data

Similar products