-
Target antigen
ASPH
-
Clonality
Polyclonal antibody
-
Clone
Polyclonal antibody
-
Raised in
rabbit
-
Type of the antibody
IgG polyclonal antibody
-
Product form
freeze-dried
-
Reacts with species
human
-
Analyses
WB,IHC-P
-
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ASPH (726-758aa EVWQDASSFRLIFIVDVWHPELTPQQRRSLPAI), identical to the related mouse sequence.
-
Product configuration
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
Purification
Immunogen affinity purified.
-
Solubilization
The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtions
Keep the ASPH Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
Tips
The ASPH Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
Background
ASPH is also known as Aspartyl/asparaginyl beta-hydroxylase. This gene is thought to play an important role in calcium homeostasis. And the gene is expressed from two promoters and undergoes extensive alternative splicing. The encoded set of proteins share varying amounts of overlap near their N-termini but have substantial variations in their C-terminal domains resulting in distinct functional properties. The longest isoforms (a and f) include a C-terminal Aspartyl/Asparaginyl beta-hydroxylase domain that hydroxylates aspartic acid or asparagine residues in the epidermal growth factor (EGF)-like domains of some proteins, including protein C, coagulation factors VII, IX, and X, and the complement factors C1R and C1S. Other isoforms differ primarily in the C-terminal sequence and lack the hydroxylase domain, and some have been localized to the endoplasmic and sarcoplasmic reticulum. Some of these isoforms are found in complexes with calsequestrin, triadin, and the ryanodine receptor, and have been shown to regulate calcium release from the sarcoplasmic reticulum. Some isoforms have been implicated in metastasis.
-
Related articles
1. "Entrez Gene: ASPH aspartate beta-hydroxylase". 2. Korioth F, Gieffers C, Frey J (Feb 1995). "Cloning and characterization of the human gene encoding aspartyl beta-hydroxylase". Gene 150 (2): 395–9. 3. Lim KY, Hong CS, Kim DH (Nov 2000). "cDNA cloning and characterization of human cardiac junctin". Gene 255 (1): 35–42.
-
Gene Name
ASPH
-
Protein Name
Aspartyl/asparaginyl beta-hydroxylase
-
Gene Full Name
aspartate beta-hydroxylase
-
Synonyms
A beta H J J antibody|AAH antibody|ASP beta hydroxylase antibody|Aspartyl/asparaginyl beta hydroxylase antibody|ASPH antibody|ASPH_HUMAN antibody|BAH antibody|Cardiac junctin antibody|CASQ2BP1 antibody|HAAH antibody|Humbug antibody|JCTN antibody|junctin antibody| Peptide aspartate beta dioxygenase antibody
-
Uniprot ID
Q12797
-
Entrez GeneID
444
-
Properties
If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translation
anticorps
