Arc Antibody
-
Catalog numberPB9753
-
PricePlease ask
-
Size0,1 mg
-
-
Target antigenArc
-
ClonalityPolyclonal antibody
-
ClonePolyclonal antibody
-
Raised inrabbit
-
Type of the antibodyIgG polyclonal antibody
-
Product formfreeze-dried
-
Reacts with specieshuman, mouse, rat
-
AnalysesWB
-
ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
-
Product configurationEach vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
-
PurificationImmunogen affinity purified.
-
SolubilizationThe powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
-
Storage condtionsKeep the Arc Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
-
TipsThe Arc Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
-
BackgroundARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
-
Related articles1. Guzowski JF, McNaughton BL, Barnes CA, Worley PF (1999). "Environment-specific expression of the immediate-early gene Arc in hippocampal neuronal ensembles." Nature Neuroscience. 2:1120-1124. 2. Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Worley PF (1995). “Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeletal-associated protein that is enriched in neuronal dendrites.” Neuron. 14:433-445. 3. Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D (1995). “Somatodendritic expression of an immediate early gene is regulated by synaptic activity.” Proc Nat Acad Sci. 6;92(12):57 34-38. 4. Vazdarjanova A, McNaughton BL, Barnes CA, Worley PF, Guzowski JF (2002). "Experience-dependent coincident expression of the effector immediate-early genes Arc and Homer 1a in hippocampal and neocortical neuronal networks." J Neurosci. 1:10067-10071.
-
Gene NameARC
-
Protein NameActivity-regulated cytoskeleton-associated protein
-
Gene Full Nameactivity-regulated cytoskeleton-associated protein
-
Synonymsactivity regulated cytoskeleton associated protein antibody|activity regulated gene 3.1 protein homolog antibody|Activity-regulated cytoskeleton-associated protein antibody|Activity-regulated gene 3.1 protein homolog antibody|Arc antibody|ARC/ARG3.1 antibody| ARC_HUMAN antibody|Arg3.1 antibody
-
Uniprot IDQ7LC44
-
Entrez GeneID23237
-
PropertiesIf you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
-
French translationanticorps
-
Gene target
-
Gene symbolARC, NOL3, ARPC1B
-
Short nameArc Antibody
-
TechniqueAntibody, antibodies against human proteins, antibodies for
-
Alternative nameactivity-regulated cytoskeleton-associated protein (antibody to-)
-
Alternative techniqueantibodies
-
Alternative to gene targetactivity-regulated cytoskeleton-associated protein, Arg3.1, ARC and IDBG-37634 and ENSG00000198576 and 23237, protein binding, Cell surfaces, Arc and IDBG-149967 and ENSMUSG00000022602 and 11838, ARC and IDBG-648018 and ENSBTAG00000021639 and 519403
-
Gene info
-
Identity
-
Gene
-
Long gene nameactivity regulated cytoskeleton associated protein
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year2000-05-23
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Gag like LTR retrotransposon derived genes
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene namenucleolar protein 3
-
Synonyms gene name
- nucleolar protein 3 (apoptosis repressor with CARD domain)
-
Synonyms
-
GenBank acession
-
Locus
-
Discovery year1999-01-13
-
Entrez gene record
-
Pubmed identfication
-
Classification
- Caspase recruitment domain containing
-
VEGA ID
Gene info
-
Identity
-
Gene
-
Long gene nameactin related protein 2/3 complex subunit 1B
-
Synonyms gene name
- actin related protein 2/3 complex, subunit 1B (41 kD)
- actin related protein 2/3 complex subunit 1B, 41kDa
-
Synonyms
-
Synonyms name
-
GenBank acession
-
Locus
-
Discovery year1999-08-06
-
Entrez gene record
-
Pubmed identfication
-
RefSeq identity
-
Classification
- WD repeat domain containing
- Actin related protein 2/3 complex subunits
-
VEGA ID
-
Locus Specific Databases
MeSH Data
-
Name
-
ConceptScope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
-
Tree numbers
- E05.196.401.143
- E05.301.300.096
- E05.478.566.320.200
- E05.601.262
- E05.601.470.320.200
-
Qualifiersethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data