Arc Antibody

  • Catalog number
    PB9753
  • Price
    Please ask
  • Size
    0,1 mg
  • Target antigen
    Arc
  • Clonality
    Polyclonal antibody
  • Clone
    Polyclonal antibody
  • Raised in
    rabbit
  • Type of the antibody
    IgG polyclonal antibody
  • Product form
    freeze-dried
  • Reacts with species
    human, mouse, rat
  • Analyses
    WB
  • Immunogen
    A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
  • Product configuration
    Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
  • Purification
    Immunogen affinity purified.
  • Solubilization
    The powdered antibody should be dissolved in 0.2 ml of distilled water to achieve final concentration of 500ug/ml
  • Storage condtions
    Keep the Arc Antibodyat minus twenty degrees Celsius for 1 year. The ready-to-use solutions can be stored at four degrees Celsius for a month. Our specialsits recommend to freeze the aliquotes at minus twenty degrees Celsius for long-term application. Multiple procedures of freezing and thawing influence the specifity and reactivity of the antibody in a negative way.
  • Tips
    The Arc Antibody did not cross-reacted with other proteins during the test procedures. This antobdy is intended to be used for research analyses and it is not applicale for in vitro diagnostics.
  • Background
    ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
  • Related articles
    1. Guzowski JF, McNaughton BL, Barnes CA, Worley PF (1999). "Environment-specific expression of the immediate-early gene Arc in hippocampal neuronal ensembles." Nature Neuroscience. 2:1120-1124. 2. Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Worley PF (1995). “Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeletal-associated protein that is enriched in neuronal dendrites.” Neuron. 14:433-445. 3. Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D (1995). “Somatodendritic expression of an immediate early gene is regulated by synaptic activity.” Proc Nat Acad Sci. 6;92(12):57 34-38. 4. Vazdarjanova A, McNaughton BL, Barnes CA, Worley PF, Guzowski JF (2002). "Experience-dependent coincident expression of the effector immediate-early genes Arc and Homer 1a in hippocampal and neocortical neuronal networks." J Neurosci. 1:10067-10071.
  • Gene Name
    ARC
  • Protein Name
    Activity-regulated cytoskeleton-associated protein
  • Gene Full Name
    activity-regulated cytoskeleton-associated protein
  • Synonyms
    activity regulated cytoskeleton associated protein antibody|activity regulated gene 3.1 protein homolog antibody|Activity-regulated cytoskeleton-associated protein antibody|Activity-regulated gene 3.1 protein homolog antibody|Arc antibody|ARC/ARG3.1 antibody| ARC_HUMAN antibody|Arg3.1 antibody
  • Uniprot ID
    Q7LC44
  • Entrez GeneID
    23237
  • Properties
    If you buy Antibodies supplied by boster they should be stored frozen at - 24°C for long term storage and for short term at + 5°C.
  • French translation
    anticorps
  • Gene target
    Arc  
  • Gene symbol
    ARC, NOL3, ARPC1B
  • Short name
    Arc Antibody
  • Technique
    Antibody, antibodies against human proteins, antibodies for
  • Alternative name
    activity-regulated cytoskeleton-associated protein (antibody to-)
  • Alternative technique
    antibodies
  • Alternative to gene target
    activity-regulated cytoskeleton-associated protein, Arg3.1, ARC and IDBG-37634 and ENSG00000198576 and 23237, protein binding, Cell surfaces, Arc and IDBG-149967 and ENSMUSG00000022602 and 11838, ARC and IDBG-648018 and ENSBTAG00000021639 and 519403
Gene info
Gene info
  • Identity
  • Gene
  • Long gene name
    nucleolar protein 3
  • Synonyms gene name
    • nucleolar protein 3 (apoptosis repressor with CARD domain)
  • Synonyms
  • GenBank acession
  • Locus
  • Discovery year
    1999-01-13
  • Entrez gene record
  • Pubmed identfication
  • Classification
    • Caspase recruitment domain containing
  • VEGA ID
Gene info
MeSH Data
  • Name
  • Concept
    Scope note: Identification of proteins or peptides that have been electrophoretically separated by blot transferring from the electrophoresis gel to strips of nitrocellulose paper, followed by labeling with antibody probes.
  • Tree numbers
    • E05.196.401.143
    • E05.301.300.096
    • E05.478.566.320.200
    • E05.601.262
    • E05.601.470.320.200
  • Qualifiers
    ethics, trends, veterinary, history, classification, economics, instrumentation, methods, standards, statistics & numerical data
Similar products
Filters
Contact
Chat with gentaur.com employee